Az előadás letöltése folymat van. Kérjük, várjon

Az előadás letöltése folymat van. Kérjük, várjon

Szilárd fázisú peptidszintézis Bánóczi Zoltán MTA-ELTE Peptidkémiai Kutatócsoport, Budapest.

Hasonló előadás


Az előadások a következő témára: "Szilárd fázisú peptidszintézis Bánóczi Zoltán MTA-ELTE Peptidkémiai Kutatócsoport, Budapest."— Előadás másolata:

1 Szilárd fázisú peptidszintézis Bánóczi Zoltán MTA-ELTE Peptidkémiai Kutatócsoport, Budapest

2 Peptidek és alkalmazásuk Peptidek aminosavakból felépülő oligomerek. H 2 N-CH-COOH R H 2 N-CH-CO- R HN-CH-CO- R HN-CH-COOH R n R: sok féle, 20 fehérjealkotó aminosav Számos alkalmazás kutatás gyógyszeripar (Inzulin, Glukagon, Octreotide, Oxicotin) édesítőszer (aszpartám: Asp-Phe-OMe) szépségápolás (botox: Clostridium botulinum toxin) -HN-CH-CO- R „A” és „Aaa” jelentése

3 Peptidszintézis - kezdetek Emil Fischer: első peptidszintézis (1903) Robert Bruce Merrifield: az első szilárdfázisú peptidszintézis (1963) J. Am. Chem. Soc. 85, 2149 Bergmann és Zervas: Z-csoport (1932) BrCH(R)COCl + H 2 N-CH(R’)CO 2 HBrCH(R)CONHCH(R’)CO 2 H H 2 NCH(R)CONHCH(R’)CO 2 H Carpino: Boc-csoport (1957) NH 3 Carpino: Fmoc-csoport (1972) E. Atherton, R.C. Sheppard: Solid phase peptide synthesis: a practical approach (IRL Press, Oxford, England, 1989) Fmoc-technika

4 Peptidszintézis - elv H 2 N-CH-COOH R R’ -H 2 O H 2 N-CH-CO- R HN-CH-COOH R’ H 2 N-CH-CO- R’ HN-CH-COOH R H 2 N-CH-CO- R HN-CH-COOH R + + és még sok minden más!!! Megoldás PG-HN-CH-COOH R H 2 N-CH-CO-OPG’ R’ PG-HN-CH-CO- R HN-CH-CO-OPG’ R’ -H 2 O PG-HN-CH-CO-AG R H 2 N-CH-COOH R’ PG-HN-CH-CO- R HN-CH-COOH R’ -H 2 O PG: védőcsoport AG: aktiváló csoport Ezt szeretnénk! Oldallánc védőcsoportok!! + + +

5 Peptidszintézis - megvalósítás PG-HN-CH-COOH R H 2 N-CH-CO-OPG’ R’ -H 2 O Hogyan? PG-HN-CH-CO- R HN-CH-CO-OPG’ R’ 1. Aktivált aminosav-származék PG-HN-CH-CO-AG R ahol AG: - Cl - N 3 - OCO-R’ - OR’ 2. Közvetlen aktiválás - karbodiimid, DCC, DIC - in situ aktív észter képzés, DCC-HOBt, BOP-HOBt +

6 Peptidlánc felépítése 1. Stepwise (lépésenkénti) szintézis: PG-HN-CH-COOH R H 2 N-CH-CO-OPG’ R’ -H 2 O PG-HN-CH-CO- R HN-CH-CO-OPG’ R’ H 2 N-CH-CO- R HN-CH-CO-OPG’ R’ amino-védőcsoport eltávolítása + + PG-HN-CH-COOH R” -H 2 O HN-CH-CO- R HN-CH-CO-OPG’ R’ PG-HN-CH-CO- R” védőcsoportok eltávolítása 1 vagy 2 lépésben HN-CH-CO- R HN-CH-CO-OH R’ H 2 N-CH-CO- R” 2. Fragmenskondenzáció

7 Miben más a szilárdfázisú peptid szintézis? 1. A C-terminális karboxil-csoport védelme a gyantával kialakított kötéssel. H 2 N-CH-CO- R’ R A kötés: - észter - amid 2. Az α-amino-csoport védőcsoportja eltávolítható a peptid-gyanta kötés hasadása nélkül. PG-HN-CH-CO- R’ R PG:- Boc - Fmoc 3. Funkciós csoportok védése az oldalláncokban.

8 Gyantatípusok Boc-technika Fmoc-technika Gyanta: polisztirol-divinilbenzol kopolimer + polimerizáció Merrifield gyanta MBHA gyanta Wang gyanta Klórtritil gyanta Rink amid-MBHA gyanta

9 Első aminosav kapcsolása a gyantához MBHA és Rink amid-MBHA, akár a többi aminosavat Wang gyanta: Fmoc-Aaa(X)-OH + DIC + DMAP H 2 N-CH-CO- R’ Klórtritil gyanta: Fmoc-Aaa(X)-OH + DIEA H 2 N-CH-CO-O R’ Merrifield gyanta Boc-Aaa(X)-OCs DMF, 50 °C, 48 h Boc-HN-CH-CO-O R’(X)

10 Peptidlánc felépítése In situ aktivészteres kapcsolás Boc-technika Fmoc-technika Aminosav származék és kapcsolószerek nagy feleslegben (3 ek.≤) DCC HOBt DIC

11 Funkciós csoportok az oldalláncban Boc-technika Lys Arg Asp, Glu Cys Ser, Thr, Tyr His Tyr Bzl 2-Br-Z Meb 2-Cl-Z OBzl OcHex Tos Dnp

12 Fmoc-technika Lys Arg Asp, Glu Cys Ser, Thr, Tyr His Boc t Bu O t Bu Trt Bum Pbf (2,2,4,6,7-pentametil- dihidrobenzofurán- 6-szulfonil)

13 Ideiglenes védőcsoport hasítása HN-CH-CO- R’(X) R Boc-technika TFA/DCM + H 3 N-CH-CO- R’(X) R + CO 2 + Fmoc-technika HN-CH-CO- R’(X) R piperidin/DMF H 2 N-CH-CO- R’(X) R + CO 2 +

14 Boc-technika szintézis protokollja 1)Gyanta mosása 3-szor DCM-nal; 0,5-1,0 perc 2)Boc-csoport hasítása 33% TFA/DCM; 2+20 perc 3)Gyanta mosása 5-ször DCM-nal; 0,5-1,0 perc 4)Semlegesítés 3-4-szer 5-10% DIEA/DCM; 1 perc 5)Gyanta mosása 4-szer DCM-nal; 0,5-1,0 perc 6)Kapcsolás: Boc-aminosav származék-DCC-HOBt DCM-DMF elegyben (3 ekv. A gyanta kapacitásához képest); 60 perc 8)Gyanta mosása 2-szer DMF-dal; 0,5-1,0 perc 9)Gyanta mosása 2-szer DMF-dal; 0,5-1,0 perc 10)Ninhidrin (izatin) teszt (-) sárga (+) kék

15 1)Gyanta mosása 3-szor DMF-dal; 0,5-1,0 perc 2)Fmoc-csoport hasítása 2% piperidin + 2% DBU/DMF; perc 3)Gyanta mosása 8-szor DMF-dal; 0,5-1,0 perc 4)Kapcsolás: Fmoc-aminosav származék-DIC-HOBt DMF-ban (3 ekv. A gyanta kapacitásához képest); 60 perc 5)Gyanta mosása 2-szer DMF-dal; 0,5-1,0 perc 6)Gyanta mosása 2-szer DCM-nal; 0,5-1,0 perc 7)Ninhidrin (izatin) teszt (-) sárga (+) kék Fmoc-technika szintézis protokollja

16 Ninhidrin teszt Izatin test: 3% izatin + 5% Boc-Phe-OH benzilalkoholban + ninhidrin teszt oldatok A gyanta színe vörös-fekete O OH OH O 2 + NH 2 -R O OHOH N O O kék λ(570nm) O-O- OHOH N O O + Pro esetén: Nincs különbség a termék és a ninhidrin színe között sárga Teszt oldatok:  40 g fenol 10 mL abs. EtOH-ban  65 mg KCN 100 mL deszt. vízben (2 mL-t higítunk 98 mL piridin-nel)  2,5 g ninhidrin 50 mL abs. EtOH-ban NH O O

17 Peptid (védőcsoportok) hasítása gyantáról Van a peptidben His(Dnp)? igen nem Dnp hasítása (tiofenol:DIEA:DMF 3:3:4 (V/V/V)) Van N-terminális Boc-csoport? igen nem Boc-csoport hasítása A peptid (védőcsoportok) kompatibilisek HF, TMSOTf, TFMSA? HF TMSOTf TFMSA Anizole, p-kresol és DTT 1 M TMSOTf-tioanizol/TFA oldat melyben m-krezol és EDT 10% TFMSA- 10% tioanizol-TFA EDT és m-krezol jelenlétében Boc-technika

18 Fmoc-technika Van N-terminális Fmoc-csoport? igen nem Fmoc hasítás Van a peptidben Arg, Met, Trp vagy Trt? yes nem Van a peptidben Arg, Met? „A” hasítási elegy igen nem „B” hasítási elegy Van a peptidben Trp vagy Trt? nem igen „C” hasítási elegy A: 0,5 mL deszt. víz 9,5 mL TFA C: 0,25 mL EDT 0,25 mL deszt. víz 9,50 mL TFA B: 0,75 g fenol 0,25 mL EDT 0,50 mL tioanizol 0,50 mL deszt. víz 10 mL TFA

19 Peptid tisztítása és jellemzése Valamennyi izolálás liofilizálással történik. Nyers peptidet RP-HPLC-val tisztítjuk. A peptid analitikai jellemzése: - analitikai RP-HPLC - tömegspektrométria

20 Miért jó a kémiai peptidszintézis? Gén-technológia népszerű, viszonylag olcsó és egyszerű, de csak hosszabb lineáris fehérjék felépítésére alkalmas L-aminosavakból. De nem lehet:  D-aminosavak  nem természetes aminosavak  poszt transzlációs módosítások(Hyp, Pyr, gliko- és foszfopeptidek)  nem lehet elágazó láncú vagy  ciklikus peptid  fluoreszcens vagy izotóp jelölt peptid

21 Nem természetes aminosavak

22 https://www.peptechcorp.com/documents/Unnatural_amino_acids_in_drug_discovery.pdf

23 Glikopeptidek T. Buskas et al. Glycobiology, 16, 113R–136R, 2006

24 Elágazó láncú peptidek Hordozó peptidek: KRRbA-NH 2 S-CH 2 CO-K(S-CH 2 CO) H-FRHDSHYX 5 C-NH 2 S-CH 2 CO-K(S-CH 2 CO) H-FRHDSHYX 5 C-NH 2 X=Ø (25, MAP(A  4-10C) 4 ) Mező, G., Manea, M. et al. J. Peptide Science 10, 701 (2004) Dendrimer szerkezetű sejtpenetráló oligoargininek vázlatos szerkezete Futaki, S., et al. Biochemistry 41, 7925–7930 (2002)

25 Ciklikus peptidek 1.Természetes anyagok; antibiotikumok, hormonok, toxinok 2.Térszerkezet rögzítése 3. Enzimstabilitás növelése A) Csak amid kötést tartalmaz - fej-farok - oldallánc is érintett B) diszulfid híd, tioéterkötés, észter (lakton), éter, oxim, tiazolidin … stb.

26 Fluoreszcensen jelölt peptidek 1.Molekulák nyomon követése – számos jelzőmolekula elérhető. 4-(7-hidroxikumaril)-ecetsav (Hca) ex = 360 nm em = 480 nm ex. = 490 nm em. = 520 nm 5-karboxifluoreszcein (Flu) O O HO NH NHS O O O Na + NH NH2H2 S O O O-O- ex. = 320 nm em. = 480 nm 5-[(2-aminoetil)amino]napftalin-1-szulfonsav (EDANS)

27 Hca- RQIKIWFQQNRRMKWKKC -NH 2 S Ac- CSK( Flu )PIGPDDAIDALSSDFTS -NH 2

28 Hca- RQIKIWFQNRRMKWKKC -NH 2 S-CH 2 CO- SKPIGPDDAIDALSSDFTS- NH 2 H- RQIKIWFQQNRRMKWKKSGKSGMDAALDDLIDTLGG -NH 2 B) HcaPenKalpC tioéter A) HcaPenKalpA amid C) HcaPenKalpC tioéter

29 2. FRET (fluorescence resonance energy transfer) DABCYL-TPLKSPPPSPRE(EDANS)RRRRRRR-NH 2

30 Hipocampus szöveteket kezeltünk 5 percig a sejtpenetráló szubsztrát oldatával (c=50  M), majd kalpasztatin A és C konjugátumot adtunk az elegyhez (c=5 μM) és a kezelést további 15 percig folytatuk. Piramidális sejtek régiója (üres nyilak) és más régiók (tele nyilak). Hipocampus szöveteket 5 percig kezeltünk a sejtpenetráló szubsztrát oldatával (c=50  M).

31 Házi feladat Hogyan állítana elő védetlen peptidet a következő származékból? Mi keletkezik a folyamat végén? (Több lépés is lehetséges!) Fmoc-Ala-Lys(2ClZ)-Thr(Bzl)-Arg(Tos)-O


Letölteni ppt "Szilárd fázisú peptidszintézis Bánóczi Zoltán MTA-ELTE Peptidkémiai Kutatócsoport, Budapest."

Hasonló előadás


Google Hirdetések