Az előadás letöltése folymat van. Kérjük, várjon

Az előadás letöltése folymat van. Kérjük, várjon

Szilárd fázisú peptidszintézis

Hasonló előadás


Az előadások a következő témára: "Szilárd fázisú peptidszintézis"— Előadás másolata:

1 Szilárd fázisú peptidszintézis
Bánóczi Zoltán MTA-ELTE Peptidkémiai Kutatócsoport, Budapest

2 Peptidek és alkalmazásuk
Peptidek aminosavakból felépülő oligomerek. H2N-CH-COOH H2N-CH-CO- HN-CH-CO- HN-CH-COOH R R R n R R: sok féle, 20 fehérjealkotó aminosav „A” és „Aaa” jelentése -HN-CH-CO- Számos alkalmazás R kutatás gyógyszeripar (Inzulin, Glukagon, Octreotide, Oxicotin) édesítőszer (aszpartám: Asp-Phe-OMe) szépségápolás (botox: Clostridium botulinum toxin)

3 Peptidszintézis - kezdetek
Emil Fischer: első peptidszintézis (1903) NH3 BrCH(R)COCl + H2N-CH(R’)CO2H BrCH(R)CONHCH(R’)CO2H H2NCH(R)CONHCH(R’)CO2H Bergmann és Zervas: Z-csoport (1932) Carpino: Boc-csoport (1957) Robert Bruce Merrifield: az első szilárdfázisú peptidszintézis (1963) Carpino: Fmoc-csoport (1972) J. Am. Chem. Soc. 85, 2149 E. Atherton, R.C. Sheppard: Solid phase peptide synthesis: a practical approach (IRL Press, Oxford, England, 1989) Fmoc-technika

4 Peptidszintézis - elv H2N-CH-COOH + H2N-CH-COOH R R’ Ezt szeretnénk!
-H2O H2N-CH-CO- HN-CH-COOH + H2N-CH-CO- HN-CH-COOH + H2N-CH-CO- HN-CH-COOH R R’ R’ R R R és még sok minden más!!! Megoldás PG-HN-CH-CO-AG + H2N-CH-COOH PG-HN-CH-COOH + H2N-CH-CO-OPG’ R R’ R R’ -H2O -H2O PG-HN-CH-CO- HN-CH-COOH PG-HN-CH-CO- HN-CH-CO-OPG’ R R’ R R’ PG: védőcsoport AG: aktiváló csoport Oldallánc védőcsoportok!!

5 Peptidszintézis - megvalósítás
PG-HN-CH-COOH R PG-HN-CH-CO- HN-CH-CO-OPG’ + H2N-CH-CO-OPG’ -H2O R R’ R’ Hogyan? 1. Aktivált aminosav-származék PG-HN-CH-CO-AG ahol AG: - Cl - N3 - OCO-R’ - OR’ R 2. Közvetlen aktiválás - karbodiimid, DCC, DIC - in situ aktív észter képzés, DCC-HOBt, BOP-HOBt

6 Peptidlánc felépítése
1. Stepwise (lépésenkénti) szintézis: PG-HN-CH-COOH R PG-HN-CH-CO- HN-CH-CO-OPG’ + H2N-CH-CO-OPG’ -H2O R R’ R’ amino-védőcsoport eltávolítása PG-HN-CH-CO- HN-CH-CO- HN-CH-CO-OPG’ H2N-CH-CO- HN-CH-CO-OPG’ R” R R’ R R’ -H2O + védőcsoportok eltávolítása 1 vagy 2 lépésben PG-HN-CH-COOH R” H2N-CH-CO- HN-CH-CO- HN-CH-CO-OH R” R R’ 2. Fragmenskondenzáció

7 Miben más a szilárdfázisú peptid szintézis?
1. A C-terminális karboxil-csoport védelme a gyantával kialakított kötéssel. A kötés: - észter - amid H2N-CH-CO- R R’ 2. Az α-amino-csoport védőcsoportja eltávolítható a peptid-gyanta kötés hasadása nélkül. PG: - Boc - Fmoc PG-HN-CH-CO- R R’ 3. Funkciós csoportok védése az oldalláncokban.

8 Gyantatípusok Gyanta: polisztirol-divinilbenzol kopolimer +
polimerizáció + Boc-technika Fmoc-technika Merrifield gyanta Wang gyanta MBHA gyanta Klórtritil gyanta Rink amid-MBHA gyanta

9 Első aminosav kapcsolása a gyantához
MBHA és Rink amid-MBHA, akár a többi aminosavat Merrifield gyanta Boc-Aaa(X)-OCs DMF, 50 °C, 48 h Boc-HN-CH-CO-O R’(X) Wang gyanta: Fmoc-Aaa(X)-OH + DIC + DMAP H2N-CH-CO- R’ Klórtritil gyanta: Fmoc-Aaa(X)-OH + DIEA H2N-CH-CO-O R’

10 Peptidlánc felépítése
In situ aktivészteres kapcsolás Boc-technika DCC HOBt Fmoc-technika DIC HOBt Aminosav származék és kapcsolószerek nagy feleslegben (3 ek.≤)

11 Funkciós csoportok az oldalláncban
Boc-technika Lys Arg Asp, Glu Cys Ser, Thr, Tyr His 2-Cl-Z Tos OBzl OcHex Meb Tyr Bzl 2-Br-Z Dnp

12 Fmoc-technika Lys Boc Arg Pbf Asp, Glu Cys Ser, Thr, Tyr OtBu His Trt
(2,2,4,6,7-pentametil- dihidrobenzofurán- 6-szulfonil) OtBu Trt tBu Bum

13 Ideiglenes védőcsoport hasítása
Boc-technika HN-CH-CO- R R’(X) TFA/DCM + CO2 + +H3N-CH-CO- R R’(X) Fmoc-technika HN-CH-CO- R R’(X) piperidin/DMF + CO2 + H2N-CH-CO- R R’(X)

14 Boc-technika szintézis protokollja
Gyanta mosása 3-szor DCM-nal; 0,5-1,0 perc Boc-csoport hasítása 33% TFA/DCM; 2+20 perc Gyanta mosása 5-ször DCM-nal; 0,5-1,0 perc Semlegesítés 3-4-szer 5-10% DIEA/DCM; 1 perc Gyanta mosása 4-szer DCM-nal; 0,5-1,0 perc Kapcsolás: Boc-aminosav származék-DCC-HOBt DCM-DMF elegyben (3 ekv. A gyanta kapacitásához képest); 60 perc Gyanta mosása 2-szer DMF-dal; 0,5-1,0 perc Ninhidrin (izatin) teszt (-) sárga (+) kék

15 Fmoc-technika szintézis protokollja
(-) sárga Gyanta mosása 3-szor DMF-dal; 0,5-1,0 perc Fmoc-csoport hasítása 2% piperidin + 2% DBU/DMF; perc Gyanta mosása 8-szor DMF-dal; 0,5-1,0 perc Kapcsolás: Fmoc-aminosav származék-DIC-HOBt DMF-ban (3 ekv. A gyanta kapacitásához képest); 60 perc Gyanta mosása 2-szer DMF-dal; 0,5-1,0 perc Gyanta mosása 2-szer DCM-nal; 0,5-1,0 perc Ninhidrin (izatin) teszt (+) kék

16 Ninhidrin teszt OH H N + NH2-R 2 O OH N O- O O kék λ(570nm)
Pro esetén: Nincs különbség a termék és a ninhidrin színe között sárga NH O Teszt oldatok: 40 g fenol 10 mL abs. EtOH-ban 65 mg KCN 100 mL deszt. vízben (2 mL-t higítunk 98 mL piridin-nel) 2,5 g ninhidrin 50 mL abs. EtOH-ban Izatin test: 3% izatin + 5% Boc-Phe-OH benzilalkoholban + ninhidrin teszt oldatok A gyanta színe vörös-fekete

17 Peptid (védőcsoportok) hasítása gyantáról
Boc-technika Van a peptidben His(Dnp)? igen nem Dnp hasítása (tiofenol:DIEA:DMF 3:3:4 (V/V/V)) Van N-terminális Boc-csoport? igen nem Boc-csoport hasítása A peptid (védőcsoportok) kompatibilisek HF, TMSOTf, TFMSA? HF TMSOTf TFMSA Anizole, p-kresol és DTT 10% TFMSA- 10% tioanizol-TFA EDT és m-krezol jelenlétében 1 M TMSOTf-tioanizol/TFA oldat melyben m-krezol és EDT

18 Van N-terminális Fmoc-csoport?
Fmoc-technika Van N-terminális Fmoc-csoport? igen nem Fmoc hasítás Van a peptidben Arg, Met, Trp vagy Trt? yes nem Van a peptidben Arg, Met? „A” hasítási elegy igen nem B: 0,75 g fenol 0,25 mL EDT 0,50 mL tioanizol 0,50 mL deszt. víz 10 mL TFA Van a peptidben Trp vagy Trt? „B” hasítási elegy igen nem „C” hasítási elegy C: 0,25 mL EDT 0,25 mL deszt. víz 9,50 mL TFA A: 0,5 mL deszt. víz 9,5 mL TFA

19 Peptid tisztítása és jellemzése
Valamennyi izolálás liofilizálással történik. Nyers peptidet RP-HPLC-val tisztítjuk. A peptid analitikai jellemzése: - analitikai RP-HPLC - tömegspektrométria

20 Miért jó a kémiai peptidszintézis?
Gén-technológia népszerű, viszonylag olcsó és egyszerű, de csak hosszabb lineáris fehérjék felépítésére alkalmas L-aminosavakból. De nem lehet: D-aminosavak nem természetes aminosavak poszt transzlációs módosítások(Hyp, Pyr, gliko- és foszfopeptidek) nem lehet elágazó láncú vagy ciklikus peptid fluoreszcens vagy izotóp jelölt peptid

21 Nem természetes aminosavak

22 https://www. peptechcorp
https://www.peptechcorp.com/documents/Unnatural_amino_acids_in_drug_discovery.pdf

23 Glikopeptidek T. Buskas et al. Glycobiology, 16, 113R–136R, 2006

24 Elágazó láncú peptidek
Hordozó peptidek: H-FRHDSHYX5C-NH2 S-CH2CO-K(S-CH2CO) H-FRHDSHYX5C-NH2 KRRbA-NH2 X=Ø (25, MAP(Ab4-10C)4) H-FRHDSHYX5C-NH2 S-CH2CO-K(S-CH2CO) H-FRHDSHYX5C-NH2 Mező, G., Manea, M. et al. J. Peptide Science 10, 701 (2004) Dendrimer szerkezetű sejtpenetráló oligoargininek vázlatos szerkezete Futaki, S., et al. Biochemistry 41, 7925–7930 (2002)

25 Ciklikus peptidek Természetes anyagok; antibiotikumok, hormonok, toxinok Térszerkezet rögzítése Enzimstabilitás növelése A) Csak amid kötést tartalmaz - fej-farok - oldallánc is érintett B) diszulfid híd, tioéterkötés, észter (lakton), éter, oxim, tiazolidin … stb.

26 Fluoreszcensen jelölt peptidek
Molekulák nyomon követése – számos jelzőmolekula elérhető. O HO lex = 360 nm lem= 480 nm lex.= 490 nm lem.= 520 nm 4-(7-hidroxikumaril)-ecetsav (Hca) 5-karboxifluoreszcein (Flu) N H S O Na+ H2 O- lex.= 320 nm lem.= 480 nm 5-[(2-aminoetil)amino]napftalin-1-szulfonsav (EDANS)

27 Ac-CSK(Flu)PIGPDDAIDALSSDFTS-NH2
Hca-RQIKIWFQQNRRMKWKKC-NH2 S Ac-CSK(Flu)PIGPDDAIDALSSDFTS-NH2

28 H-RQIKIWFQQNRRMKWKKSGKSGMDAALDDLIDTLGG-NH2
Hca-RQIKIWFQNRRMKWKKC-NH2 S-CH2CO-SKPIGPDDAIDALSSDFTS-NH2 H-RQIKIWFQQNRRMKWKKSGKSGMDAALDDLIDTLGG-NH2 A) HcaPenKalpA amid B) HcaPenKalpC tioéter C) HcaPenKalpC tioéter

29 DABCYL-TPLKSPPPSPRE(EDANS)RRRRRRR-NH2
2. FRET (fluorescence resonance energy transfer) DABCYL EDANS TPLKSPPPSPR N C H 3 O S Na+ O- DABCYL-TPLKSPPPSPRE(EDANS)RRRRRRR-NH2 cszubsztrát= 200 mM. , cKalpainB= 0,5 µM lgerj.=320 nm, lem.= 480 nm Emésztés előtt Emésztés után lgerj. 5 10 15 20 25 30 35 40 350 400 450 500 550 600 650 (nm) F Int.

30 Hipocampus szöveteket 5 percig kezeltünk a sejtpenetráló szubsztrát oldatával (c=50 mM).
Hipocampus szöveteket kezeltünk 5 percig a sejtpenetráló szubsztrát oldatával (c=50 mM), majd kalpasztatin A és C konjugátumot adtunk az elegyhez (c=5 μM) és a kezelést további 15 percig folytatuk. Piramidális sejtek régiója (üres nyilak) és más régiók (tele nyilak).

31 Házi feladat Hogyan állítana elő védetlen peptidet a következő származékból? Mi keletkezik a folyamat végén? (Több lépés is lehetséges!) Fmoc-Ala-Lys(2ClZ)-Thr(Bzl)-Arg(Tos)-O


Letölteni ppt "Szilárd fázisú peptidszintézis"

Hasonló előadás


Google Hirdetések