Az előadás letöltése folymat van. Kérjük, várjon

Az előadás letöltése folymat van. Kérjük, várjon

Bioinformatika Dr. Miskei Márton Tudományos munkatárs.

Hasonló előadás


Az előadások a következő témára: "Bioinformatika Dr. Miskei Márton Tudományos munkatárs."— Előadás másolata:

1 Bioinformatika Dr. Miskei Márton Tudományos munkatárs

2 Mi az a bioinformatika? A bioinformatika a számítógépes módszerek kidolgozása és alkalmazása a biológiai információ kezelésére és elemzésére Bioinformatika célja Adatbázisok létrehozása Módszerek kifejlesztése az adatok elemzésére Ezen eszközök, módszerek alkalmazása, az eredmények értelmezése biológiai vizsgálatokban

3 Genomok Genomi adatbázisok a „genome project”-ek erdményei Emberi genom További főemlősök (pl.: gorilla, csimpánz, orángután) Egyéb emlősök (pl.: patkány, egér, nyúl, disznó) Egyébb gerincesek (pl.: zebrahal, béka, tyúk) Gerinctelenek (pl.: laposféreg) Növények (pl.: lúdfű) Gombák (pl.: élesztők) Baktériumok Vírusok és bakteriofágok

4 Adatbázisok létrehozása 1.Genom szekvenálása 2.ORF meghatározás 3.CDS meghatározás alapján a fehérje szekvencia meghatározása 4.Fehérjék doménszerkezetének meghatározása 5.Fehérjék alapján homológia keresés 6.Fehérje doménszerkezete, homológia keresés és kisérlettes munka alapján a fehérjék annotálása megfelelő referenciákkal

5 Szekvenálás Hagyományos Shotgun BAC klón

6 Szekvenálás

7 ORF és CDS meghatározás ORF: „Open Reading Frame” TATGTTAGGTTAGAC M L G * C * V R V R L D TATGTTAGGTTAGAC

8 ORF, CDS, protein szekvencia meghatározás 1.START hely (ATG) 2.STOP hely (TAA, TAG) 3.Intron felismerő szekvenciák alapján az intronok megtalálása ORF START STOP Exon 1 Exon 2 Exon 3Intron 1 Intron 2 CDS (feltételezett) fehérje elsődleges és másodlagos szerkezet Exon 1 Exon 2Exon 3

9 Fehérjék doménszerkezetének meghatározása Doménadatbázisok alapján, szekvencia hasonlósággal doménkeresés >RLK (receptor lectin kinase) Arabidopsis thaliana MFLKLLTIFFFFFFNLIFQSSSQSLNFAYNNGFNPPTDLSIQGITTVTPNGLLKLTNTTVQKTGHAFYTKPIRFKDSPNGT VSSFSTSFVFAIHSQIAILSGHGIAFVVAPNASLPYGNPSQYIGLFNLANNGNETNHVFAVELDTILSTEFNDTNDNHVGI DINSLKSVQSSPAGYWDEKGQFKNLTLISRKPMQVWVDYDGRTNKIDVTMAPFNEDKPTRPLVTAVRDLSSVLLQDMYVGF SSATGSVLSEHYILGWSFGLNEKAPPLALSRLPKLPRFEPKRISEFYKIGMPLISLFLIFSFIFLVCYIVRRRRKFAEELE EWEKEFGKNRFRFKDLYYATKGFKEKGLLGTGGFGSVYKGVMPGTKLEIAVKRVSHESRQGMKEFVAEIVSIGRMSHRNLV PLLGYCRRRGELLLVYDYMPNGSLDKYLYNTPEVTLNWKQRIKVILGVASGLFYLHEEWEQVVIHRDVKASNVLLDGELNG RLGDFGLARLYDHGSDPQTTHVVGTLGYLAPEHTRTGRATMATDVFAFGAFLLEVACGRRPIEFQQETDETFLLVDWVFGL WNKGDILAAKDPNMGSECDEKEVEMVLKLGLLCSHSDPRARPSMRQVLHYLRGDAKLPELSPLDLSGSGMMFGVHDGFSEL GMSYSSSVFKGFTGGSSIADSQLSGGR Szignál peptid Transzmembrán domén Katalitikus domén

10 Homológia keresés nukleinsav blastn protein blastx, tblastn, tblastx Hasonlóságokat állapít meg Hasonlósági mátrixok (BLOSUM 62) Jutalom és büntető pontok blastp

11 Cikkek keresése és letöltése Leghasznosabb az NCBI honlap Szerző, cím vagy kulcsszó alapján kereshető A cikkek egy réssze letölthető (pdf) Absztrakt megtalálható

12 Annotálás és funkcionális csoportokba sorolás Ismeretlen fehérjét kódoló ORF Homológia keresés Amennyiben találunk funkcionálisan leírt ortológot, feltételezhetjük, hogy azonos funkciót végez az ORF által kódolt fehérje Kísérletesen igazolható a funkciók azonossága Funkcionális csoportosítás (GO szám)

13 Filogenetika Az összevetendő szekvenciák kigyüjtése A szekvenciákat FASTA formátumú átalakítása ClustalW multiple alignment Dendogram rajzolása

14 Programok pDRAW32 Alkalmas a DNS szekvenciák manipulálásának tervezésére (génebészet)

15 Programok pDRAW32

16 Programok

17 Programok

18 Programok Oligo Explorer Primer tervezés PCR munkára

19 Programok Oligo Explorer

20 Programok Oligo Analyser Primer ellenőrzés

21 Programok BioEdit

22 Programok BioEdit ClustalW többszörös szekvencia összerendezés

23 Programok BioEdit

24 Programok MEGA 4

25 Programok MEGA 4 ClustalW többszörös szekvencia összerendezés

26 Programok MEGA 4 Filogenetikai fa rajzolás és ellenőrzés

27 Köszönöm


Letölteni ppt "Bioinformatika Dr. Miskei Márton Tudományos munkatárs."

Hasonló előadás


Google Hirdetések