Az előadás letöltése folymat van. Kérjük, várjon

Az előadás letöltése folymat van. Kérjük, várjon

A publikus adatbázisból hiányzó fehérjék azonosítási lehetõségei >gi|39578743|emb|CAE57166.1| Hypothetical protein CBG25105 [Caenorhabditis briggsae] MTIASKERRCARLLTQSDATSYFEKYKRVRSTDMKVQQCQSVAFNCDGTKLVCGAFDKKVSIANVDGGRLRFSWVGSSHT.

Hasonló előadás


Az előadások a következő témára: "A publikus adatbázisból hiányzó fehérjék azonosítási lehetõségei >gi|39578743|emb|CAE57166.1| Hypothetical protein CBG25105 [Caenorhabditis briggsae] MTIASKERRCARLLTQSDATSYFEKYKRVRSTDMKVQQCQSVAFNCDGTKLVCGAFDKKVSIANVDGGRLRFSWVGSSHT."— Előadás másolata:

1 A publikus adatbázisból hiányzó fehérjék azonosítási lehetõségei >gi| |emb|CAE | Hypothetical protein CBG25105 [Caenorhabditis briggsae] MTIASKERRCARLLTQSDATSYFEKYKRVRSTDMKVQQCQSVAFNCDGTKLVCGAFDKKVSIANVDGGRLRFSWVGSSHT SSVEQVACSEKQPNMFASASSDRNVCIWDARQSKPTHRITNKVGNFFVSWSPCDEYLIFLDKDNRVNTVDVRNYKVVN >gi| |emb|CAE | Hypothetical protein CBG25098 [Caenorhabditis briggsae] MVENWDTSYAQVEEALLKSWPKNKESCAQLLIGYFDYYSRFDFRNFVVQCRREMTLSKMEKEWPRPICVEDPFDLNHNLS SGVTKKMFVFIMKVFINSRAVFMSEKPKMTDHNHAGFHLMYRKVLLDKCHQGSAPSDRQCHSCHRIGHFYESCPFRMQGK DNRRRYTSNSTNNSYRSTTGSIITGRRQRILMVLEIDWAIIKG >gi| |emb|CAE | Hypothetical protein CBG25096 [Caenorhabditis briggsae] NVLHVIPMFPMASFIGYKAHFCYGDQLKKISESSAHILEESVDSLVPLPPTLDDVRHRSKQLKEEESLANF >gi| |emb|CAE | Hypothetical protein CBG25094 [Caenorhabditis briggsae] MNGFRKLDHLNSASLTLKHLLNNSTVHQSPQSAIAEFVDNSYDANAKNCSIEVYDTPNNERIEILDDGDGMTRSEALNIV KFGFSNKVDNAIGRYGMGLKSGGLYIGRDILLLTKKDDEETAVFISHSFLRAENTDEKVYIPSPSWKYGEAHVPTIEDAE RFDDECGIINQYMSVEGYESFEQLFDKIPGEHGTLIIISKLQRDPRGELEINITGDKWDIQDIGDNLPPHKLSLRKYLEI LYLNPKMAITLRGKDVYPRNVVDNWMARYTVEYNGDMSTESLNKTIHEIQAQKAQ >gi| |emb|CAE | Hypothetical protein CBG25093 [Caenorhabditis briggsae] PKNMIPMENKNLYPISDEDEIDVLNSDDEEMLPEGSFHHQPDEIYMVQEDGEGYYDDDDEDDPLQEYQYVEEDGVL >gi| |emb|CAE | Hypothetical protein CBG25092 [Caenorhabditis briggsae] MSIINLLEPFQYNFRTQIFANPNKFIRAVVLYNKSQIFESFQSSGHDTFGGETAISRMFLCPPDSKTNLLTARRSFRNYH HLSSSLCSDCRFNQKRQRRLAKKEWEKRRISTECLMKFGKEKREQLRNQSILTKSRIEAADQSLFRANEMSSNGDSFGVF QNIEGVGDVENDDDDDGFF >gi| |emb|CAE | Hypothetical protein CBG25091 [Caenorhabditis briggsae] PTPSSTITSVPTTVSTFTYEPPPASTFTAEPTPSSTITSVQTTVSTLTNEPPPASTFTAEPTSSSTITSEPPPSSTITSE PTPSLTITSEPPPSLTITSEPPTPSTITSEHSPASTITSEPPPSSTIISEPPPSSTITSEPHPSSTITPVPPPASTIASE PTPSSTITSVPTTVSTFTTEPPPSSTFTAEPTPSSTITSEPTPSLTITSEPPPSSTITSEPPPSSTITSEPTPSSTIPSE PTPSLTITSEPPPSLTITSEPPPSLTITSEPPPSSTITSEPLPASTFTDEPTPSLPILSEPLPSSTITSDASPLQLSPLN HLHLQLSPLYLPQFQLSPLNLLRRQAFTAEPTPSLTITSEPPPSLTITSEPPPPSTITSEHSPASTITSETPPSSTITSE PPPSSTIISEPPPSSTITSEPTPSLTITSEPTPSLTITSEPPPSLTITSEPPPSSTITSEPLPASTITSVPTTVSTFTSE PPPASTFTAEPTPSSTITSELPPSSTITSEPTPSLTITSEPTPSLPITSEPSPSLTITSEPPPSLFCRHIALVRPLETR >gi| |emb|CAE | Hypothetical protein CBG25090 [Caenorhabditis briggsae] MLENLLKENLLKENLLKENLLKENLLKEENLLKENLHEENLPKENLPKENLPKENFPKENLPKENLPKENLPKENLPKEN FPKEYFPKENLHKENVRKENLPKENLPKENLPKEENLPKENLPKENLPKENLPKENLPKENLPKENLPKENLPKENLPKE NLPKENLPKENLPKENLPKENLPKENLPKENLPKENLPKENLPKENLPKENLPKENLPKENLPKENLPKENLPKENLPKE NLPKENLPKENLPKENLPKENLPKENLPKENLPKENLPKENLPKENLPKENLPKENLPKKNLPKEENLPKENLPKENLPK ENLPKENLPKENLPKEENLPKENLPKENFPKENLPKEENLPKEENLPKEENLPKEENLPKEENLPKENLPKENLPKKIFL KKKIFLKKKIFLKKIFLKKIFLKKIFLKKIFLKNLPKEENLPKEENLPKEENLPKEENLPKDHLPKDHL >gi| |emb|CAE | Hypothetical protein CBG25088 [Caenorhabditis briggsae] KWIQWYLLRMLLQLKMGQRTVDILHQKGISIRILSKKNTSKIESIRYEYNVGYFDKQVQLMNWIIQMFRFSGEKIVVAIQ RNSKERFLFRNRLRVTLWKRNAGGRRDYVPIHDASIPYPAHWPTDLIHFINAMLKFDKEKRLVGLEAIKKHAYTERIDFK SVFERKPAPVFIPCKEGLNCDPMYELEERILVSTPIHRRRTNHNNSSGRSSSEPQNAALVEVSKAFIDFSRHNMKIEPNG VCRSN >gi| |emb|CAE | Hypothetical protein CBG25086 [Caenorhabditis briggsae] MEPKEPELTQEEIDHIAWIEKIAEQSSFEQMTAPPTRPPVPIKMATVDEPVVVTEAHEDEDRSSATSGADFQQSFDHEVT YERSSPLLEPDEVPVMEPKEPELTQEEIDHIAWIEKIAEQSSFEQMNAPPTRPPVPIKMATVDEPVVVTEAHEDEDRSSV TSGADFQQSFDHEVTYERSSPLLEPVEEPVMEPKEPELTQEEIDHIAWIQKIAEQSSFEQTTAPPTRPPVPIRMATVDEP NIVTEAHEDEDRSSATSGADFQQSFDHEVTYERSSPLLEPVEIPVKEPKEPELTQEEIDHIAWIEKIAEQSSFEQMTAPP TRPPVPIRMATVDEPNIVTEAHEDEHRSSATSGADFQQSFDHEVTYERSSPLLEPVEEPVMEPKEPQLPQEEIVHIAWIE KIAAQSSFEQMTAPPTRPPVPIRMAAVEEPNIVTEAHEDEDRSSATSGADFQQSFDHEVTYERSSPLLEPVEEPVMEPKE PELTQEEIDHIAWIEKIDEQSSFEQMTAPRTRPPVPIKMTTVDEPVVVTEAHEDEDRSSATSGADFQQSFDHEVTYERSS PLLEPVEIPVIEPKEPELTQEEIDHIAWIEKIAEQSSFEQMTAPPTRPPVPIRMAT >gi| |emb|CAE | Hypothetical protein CBG25085 [Caenorhabditis briggsae] MTDGEESFKYYSKMKYLEDTQVLRCLVHRRNNLTFIQSKKNISQSDLNKIFGRQIGDEVENGIFNVMSSEAMEAEIVKYE KKEFCKSILTGKSELIRYANFKKTGILSAQSQVKALRKHGFRTFSLSHVFEMPKTVWRSVPKQMKIGEVFNKNVIYHKSG QYLVEKDDKSFFVVKTTETNIECKDPKCASKPAITCSHVFAVLSTLPTKKCQEVLNIREKFLISLSRSLQIKSINDGKDA KRYPNRKYSKRSHNNGGRTVSEFKKVNRNVSGESESGDDERKADGNISSDEENDSDCDVNSLNSKPNVFDESGDIVEDEI SCNSNDEHVNLVLDPSVDHLNSHDSCMDLSDDPRKYDSDSDEENDIFGYQNVNPVPKPSNRVSNDHSSQIDLRDVLGEKG SRKPESDSEEVTDVSTGQHVKPMSLKEKFPIGYMHRLSDDSDDSET >gi| |emb|CAE | Hypothetical protein CBG25084 [Caenorhabditis briggsae] MRFFFLLHILLMLHHFISHLLIQRAACGAHIADQVLEIMPFFDQHTELLSIHSVGPWRISFLISSVFSFFFFSAAFIFST FLKVASPPEATADQKSRLDMLVQKVLNVGIDSKAQIQERTKEKVGKVMKETEEIKGKFMDIKKFTLADKRGKPIKEELEM EKKKRQMLLDEIKRLGEAKEEMSNDDDEPFENLMKEIDKLFEEADENRKLQKEADKEIATAATRQDAVFNEEMEEIEKFL SDIRNADKLQL >gi| |emb|CAE | Hypothetical protein CBG25082 [Caenorhabditis briggsae] EFQNFRKTHKNSEFRNFRNLETQGSEKSEFQISGFRFQILYFRFQISDFRFQISDFRFQISDFRFQISDFRFQISDFRFQ ISDQISDFGEENVEASFYLSLKIFSEFQISGFQNFRKTHKNSEFRNFRNLETQGSEKFQISDFIFQISDFRFQISDFRFQ ISDFRFQISDFRFQISDFRFQISDFRFQISDFRFQISDQISDFGEENVEASFYLSLK >gi| |emb|CAE | Hypothetical protein CBG25081 [Caenorhabditis briggsae] MYSWTRSRYWLTRSMWRWIQSRYSWWTRSMYSWTRSRWRWIQSRYSWTRSRYSLTRSMWRWIQSRYLWTRSRYSWTRSMW RWIQSMYSWTRSRWRWIQSRYSWTRSRYSLTRSKWRWIQSRYSWTRSRYSWTRSMWRWIQSRYSWTRSRYSWTRSMWRWI QLRYSWTRSRYSLTRSRWRWIQSMYSWTRSRWRWIQSMYSWTQSRWRWIQSRYSWTRSRYSLTRSMWRWIQSRYSWTRSR YWLTRSMCRWIQSRYLWTRSRYSWTRSRWRWIQSRYSWTRSRWRWIQSRYSWTRSRYSWTRSKCRWIQSRYSWTRSRYSW TRSMWRWIQLRYSWTRSRYSWTRSMWRWIQSRYLWTRSRYSWTRSMWRWIQSMYSWTRSRWRWIQSRYSWTRSRYSLTRS KWRWIQSRYSWTRS >gi| |emb|CAE | Hypothetical protein CBG24048 [Caenorhabditis briggsae] GLTEYVTVMACIVVDAEPIFGAIYRPFFNETIFGLQGFGVVTSDGKKISPVDEGKTDKKVVVSRSHAGKVKEIVEKVYGD KMTIEAAGGSGYKTLRLVNGTAGKGNKYIF >gi| |emb|CAE | Hypothetical protein CBG25080 [Caenorhabditis briggsae] TKPNPQNMLIGKQKKAKAEGYDTNSLAIHSKVNASDFIKSSGYLDILGEANVILLDDPKWKNHEKTTEEVVEYMKDVKVL GPRELRVLLRWRKSMLETLEAERKAVEGEAQDVEIEEDLTEEQIEDRAMAEIDELIAKASEDEKAALKKKKKKMLKAKAR VLKRRELKMIIDGDEGPQAEDQEVFQLKKIRKAKELAEITKETQAPDFENVEGKGAGWRGWGGREWLYLEISLFSAVF >gi| |emb|CAE | Hypothetical protein CBG25077 [Caenorhabditis briggsae] MWAEPHHRISELFQNFRISESQNLRISESQNLRISESQNLRISESQNLRISESQNLRISESQNLRISESQNLRISESQNL RISESQNLRISESQNLRISESQNLRISESQNLRISESQNLRISESQNLRISESQNLRISESQNLRISESQNLRISEFQNL RISESQNLRISEFQNLRISESQNLRISESQNLRISESQNLRISESQNLRISESQNLRISEFQNF >gi| |emb|CAE | Hypothetical protein CBG23749 [Caenorhabditis briggsae] MPNRERYVKKFTVEQKRKMDEVFVASRNPEKGKIAALVAELELTTTQVRQYFRKQRFKNPIPEEIPRFLSEEQVEHGIVD GETFKRERNSEKRNQFEDAMEKFFEERQFLEEPDETLELESGGSRKRISDWLDKKRYDTLKSFLEKEISVLPNEMATFEK LSEKYCLDTTTHPDVILYIEMKED >gi| |emb|CAE | Hypothetical protein CBG25076 [Caenorhabditis briggsae] GNFHNYVCSVNGTSPDPRYKRFINFSKKLRNCGIQVTMAQMFMFQKDENSFLDYNKERSPYFKFSEICITDWEKFWKKLL QFSCSLAGYSSSHLAFYSHDLARKVLKI >gi| |emb|CAE | Hypothetical protein CBG25074 [Caenorhabditis briggsae] NGGYSHRSTLSRDLPSEETITSITPFDEEKLSDDSIDQSAQEISHSSKTDDMSDEKMSGVSISPIDPDESIQLTLPNEQE ASRSSITEGIAEEMLPVDPIGTVAQGESVPSFPPTSFSDTIAQLRLYFNQELSNEGAMPAVSADRAIHSAKRTSSVPIRQ YSSDTVDENELAVKKPRFFSPQRQVLKPLNTSYKLAMSPEAPSSEHPNSLVEPLVVLQKSPEEPWAELLNRPKTQTLPEA LQQLRPLKRYGKQVTLKEYLQIQFKGQLLRTIDWNRVDDLKLFHPKTALFQSTNHPILLLAGKSFNRALLVEGNHRTAAL SECHAQKELSDDDLKSTVPLTFFQIPKPEFNNMWMAANELGRQVQAQARFDWKNASSRTREAVFSEFKKEAYRTKGKFSK FESSIL >gi| |emb|CAE | Hypothetical protein CBG25073 [Caenorhabditis briggsae] MVLYQMTLFFSVQMLFAIFLEYMPKTYCTDDDYCYKMKNKCLTDFIREDDSQICPYNSTDFKQCVLDAKRVDFRSAQFDY QQDCTGLKHFSSSTATFIGTLLGNLVLIYLSDTIGRRPVFIFSIALGVPALILSAAINGVMNFYIFRFIVGFAVAGTLTV GWTYSSEMITPSRRFRLRTFPNWA >gi| |emb|CAE | Hypothetical protein CBG25071 [Caenorhabditis briggsae] MAFIFSTGYQMAFMQYGMTTIITLNRLTVLLNFTFFEPIWKKYSWLLVIFLIFLPFLSTKVALNYDSKFSYQNSTDYFLL TSGMPVWEIYSILIPFMIVTIVTSLAANLSSFVFVKHRKLVMAYKA >gi| |emb|CAE | Hypothetical protein CBG25072 [Caenorhabditis briggsae] ITSITLIIQVIGNFLSIGMLTFEHSDYLPYLSIIRPFVSDGLTLVQPWLLYFFSSPMRKKLQQMFKRSSPATVATVVFKS RSV >gi| |emb|CAE | Hypothetical protein CBG25067 [Caenorhabditis briggsae] MYGLGFVVNSAKLANARSLWFNVGALNHLHRTWSLGQGVVFSRAVLLSCDLLRLSFD >gi| |emb|CAE | Hypothetical protein CBG24068 [Caenorhabditis briggsae] MKKITESGIRNPEISGFKNGSYPRTQVIATMVIPGNMPSAFPFFLTFKLVSSCSTSSFFHKSLGNLNFRSKSVTMAKGNI FVRFKNYIVETISDTYHHIRELRAEWNRQQGRG >gi| |emb|CAE | Hypothetical protein CBG25066 [Caenorhabditis briggsae] SPFKDEAVFRFSNWFKKLGDEDKDKEAEEKEKELAEIAETRFLENKQKFRSLLIERKFSAEEWTLMKQFLDYPELAAIVV KMRRSQGVPGLRQNRRRCLTCEESLAGMPLTAHKTENCSIPYESRILVSKRLFGQRKCYGCGRMKEDGNCNCKSVPCRRC WRWNVPESFPHLQVMGTCQMVWKIRQETGHVPTEHEISDYTKRNDKIASIIQHKLEKFVAETERELVDAGRASNQKTEAE LWWVADKYRTLAFSIPWHGAKGYFRKISKLFESPETI >gi| |emb|CAE | Hypothetical protein CBG24269 [Caenorhabditis briggsae] MIEAVDRILVVDASIVTDTSIQKENLISSSLNQHGEINFVIETCDQYLHLHKSYIYLEVDLSKLDDTALAETDEVSLTNN APMFLFDRATYSMDGVQVENIWILVELV >gi| |emb|CAE | Hypothetical protein CBG25062 [Caenorhabditis briggsae] VLQTDESGNYIYPAVGPDGQVLPTDATGKTVYPVRGPDGTPLPTDASGAVIGPDGEPIPTDASGKPLSQDGSPLPTDNQG NYVLVPTGEDVTKYLPTDESGNVIYPITRPDGTPLGTDASGNFVTDDGTVVEKDDEGKPVGPDGAVLPTDASGNYIYPVV GPDGQVLPTDATGKTVYPVRGPDGTPLPTDGSGAVIGPDGEPIPTDPSGKPLSKDGSPLPTDASGNYILVPAEEETTKTL PTDSEGNVIYPITNPDGTPLGTDSSGAFVTQDGTVIEKNEDGKPVGPDGQFVYSVIADIFFPYLQNQGPVLQISKKN >gi| |emb|CAE | Hypothetical protein CBG25061 [Caenorhabditis briggsae] MGMKWTGLTFEIAAEEMRRLKSTPSEREQMKLYGLYKQALHGDIPNEDVYPVSQKEKQSLEPEKSSALAERVYLTN >gi| |emb|CAE | Hypothetical protein CBG24622 [Caenorhabditis briggsae] SSFFGMLVYCVRVCMYVNDTEKEGEREELSMSYNQKRYTPKRRRNEIDDMMNAGQMAVGSSGTIAMGTGVPQKKDDMDAL STLERDVAKRTQHAQQILLRQRANQSTPRSVTPPPQPQEFKTYVISAPQQQHQQHVGNNGHQQVLHGGHMQQQQQIQVSH QEIMSEKAKFGSANVARVSLRLHWPAKYLADHFFV NO MATCH! Csorba Attila esettanulmánya az adatbázisokkal

2 A publikus adatbázisból hiányzó fehérjék azonosítási lehetõségei >gi| |emb|CAE | Hypothetical protein CBG25105 [Caenorhabditis briggsae] MTIASKERRCARLLTQSDATSYFEKYKRVRSTDMKVQQCQSVAFNCDGTKLVCGAFDKKVSIANVDGGRLRFSWVGSSHT SSVEQVACSEKQPNMFASASSDRNVCIWDARQSKPTHRITNKVGNFFVSWSPCDEYLIFLDKDNRVNTVDVRNYKVVN >gi| |emb|CAE | Hypothetical protein CBG25098 [Caenorhabditis briggsae] MVENWDTSYAQVEEALLKSWPKNKESCAQLLIGYFDYYSRFDFRNFVVQCRREMTLSKMEKEWPRPICVEDPFDLNHNLS SGVTKKMFVFIMKVFINSRAVFMSEKPKMTDHNHAGFHLMYRKVLLDKCHQGSAPSDRQCHSCHRIGHFYESCPFRMQGK DNRRRYTSNSTNNSYRSTTGSIITGRRQRILMVLEIDWAIIKG >gi| |emb|CAE | Hypothetical protein CBG25096 [Caenorhabditis briggsae] NVLHVIPMFPMASFIGYKAHFCYGDQLKKISESSAHILEESVDSLVPLPPTLDDVRHRSKQLKEEESLANF >gi| |emb|CAE | Hypothetical protein CBG25094 [Caenorhabditis briggsae] MNGFRKLDHLNSASLTLKHLLNNSTVHQSPQSAIAEFVDNSYDANAKNCSIEVYDTPNNERIEILDDGDGMTRSEALNIV KFGFSNKVDNAIGRYGMGLKSGGLYIGRDILLLTKKDDEETAVFISHSFLRAENTDEKVYIPSPSWKYGEAHVPTIEDAE RFDDECGIINQYMSVEGYESFEQLFDKIPGEHGTLIIISKLQRDPRGELEINITGDKWDIQDIGDNLPPHKLSLRKYLEI LYLNPKMAITLRGKDVYPRNVVDNWMARYTVEYNGDMSTESLNKTIHEIQAQKAQ >gi| |emb|CAE | Hypothetical protein CBG25093 [Caenorhabditis briggsae] PKNMIPMENKNLYPISDEDEIDVLNSDDEEMLPEGSFHHQPDEIYMVQEDGEGYYDDDDEDDPLQEYQYVEEDGVL >gi| |emb|CAE | Hypothetical protein CBG25092 [Caenorhabditis briggsae] MSIINLLEPFQYNFRTQIFANPNKFIRAVVLYNKSQIFESFQSSGHDTFGGETAISRMFLCPPDSKTNLLTARRSFRNYH HLSSSLCSDCRFNQKRQRRLAKKEWEKRRISTECLMKFGKEKREQLRNQSILTKSRIEAADQSLFRANEMSSNGDSFGVF QNIEGVGDVENDDDDDGFF >gi| |emb|CAE | Hypothetical protein CBG25091 [Caenorhabditis briggsae] PTPSSTITSVPTTVSTFTYEPPPASTFTAEPTPSSTITSVQTTVSTLTNEPPPASTFTAEPTSSSTITSEPPPSSTITSE PTPSLTITSEPPPSLTITSEPPTPSTITSEHSPASTITSEPPPSSTIISEPPPSSTITSEPHPSSTITPVPPPASTIASE PTPSSTITSVPTTVSTFTTEPPPSSTFTAEPTPSSTITSEPTPSLTITSEPPPSSTITSEPPPSSTITSEPTPSSTIPSE PTPSLTITSEPPPSLTITSEPPPSLTITSEPPPSSTITSEPLPASTFTDEPTPSLPILSEPLPSSTITSDASPLQLSPLN HLHLQLSPLYLPQFQLSPLNLLRRQAFTAEPTPSLTITSEPPPSLTITSEPPPPSTITSEHSPASTITSETPPSSTITSE PPPSSTIISEPPPSSTITSEPTPSLTITSEPTPSLTITSEPPPSLTITSEPPPSSTITSEPLPASTITSVPTTVSTFTSE PPPASTFTAEPTPSSTITSELPPSSTITSEPTPSLTITSEPTPSLPITSEPSPSLTITSEPPPSLFCRHIALVRPLETR >gi| |emb|CAE | Hypothetical protein CBG25090 [Caenorhabditis briggsae] MLENLLKENLLKENLLKENLLKENLLKEENLLKENLHEENLPKENLPKENLPKENFPKENLPKENLPKENLPKENLPKEN FPKEYFPKENLHKENVRKENLPKENLPKENLPKEENLPKENLPKENLPKENLPKENLPKENLPKENLPKENLPKENLPKE NLPKENLPKENLPKENLPKENLPKENLPKENLPKENLPKENLPKENLPKENLPKENLPKENLPKENLPKENLPKENLPKE NLPKENLPKENLPKENLPKENLPKENLPKENLPKENLPKENLPKENLPKENLPKENLPKKNLPKEENLPKENLPKENLPK ENLPKENLPKENLPKEENLPKENLPKENFPKENLPKEENLPKEENLPKEENLPKEENLPKEENLPKENLPKENLPKKIFL KKKIFLKKKIFLKKIFLKKIFLKKIFLKKIFLKNLPKEENLPKEENLPKEENLPKEENLPKDHLPKDHL >gi| |emb|CAE | Hypothetical protein CBG25088 [Caenorhabditis briggsae] KWIQWYLLRMLLQLKMGQRTVDILHQKGISIRILSKKNTSKIESIRYEYNVGYFDKQVQLMNWIIQMFRFSGEKIVVAIQ RNSKERFLFRNRLRVTLWKRNAGGRRDYVPIHDASIPYPAHWPTDLIHFINAMLKFDKEKRLVGLEAIKKHAYTERIDFK SVFERKPAPVFIPCKEGLNCDPMYELEERILVSTPIHRRRTNHNNSSGRSSSEPQNAALVEVSKAFIDFSRHNMKIEPNG VCRSN >gi| |emb|CAE | Hypothetical protein CBG25086 [Caenorhabditis briggsae] MEPKEPELTQEEIDHIAWIEKIAEQSSFEQMTAPPTRPPVPIKMATVDEPVVVTEAHEDEDRSSATSGADFQQSFDHEVT YERSSPLLEPDEVPVMEPKEPELTQEEIDHIAWIEKIAEQSSFEQMNAPPTRPPVPIKMATVDEPVVVTEAHEDEDRSSV TSGADFQQSFDHEVTYERSSPLLEPVEEPVMEPKEPELTQEEIDHIAWIQKIAEQSSFEQTTAPPTRPPVPIRMATVDEP NIVTEAHEDEDRSSATSGADFQQSFDHEVTYERSSPLLEPVEIPVKEPKEPELTQEEIDHIAWIEKIAEQSSFEQMTAPP TRPPVPIRMATVDEPNIVTEAHEDEHRSSATSGADFQQSFDHEVTYERSSPLLEPVEEPVMEPKEPQLPQEEIVHIAWIE KIAAQSSFEQMTAPPTRPPVPIRMAAVEEPNIVTEAHEDEDRSSATSGADFQQSFDHEVTYERSSPLLEPVEEPVMEPKE PELTQEEIDHIAWIEKIDEQSSFEQMTAPRTRPPVPIKMTTVDEPVVVTEAHEDEDRSSATSGADFQQSFDHEVTYERSS PLLEPVEIPVIEPKEPELTQEEIDHIAWIEKIAEQSSFEQMTAPPTRPPVPIRMAT >gi| |emb|CAE | Hypothetical protein CBG25085 [Caenorhabditis briggsae] MTDGEESFKYYSKMKYLEDTQVLRCLVHRRNNLTFIQSKKNISQSDLNKIFGRQIGDEVENGIFNVMSSEAMEAEIVKYE KKEFCKSILTGKSELIRYANFKKTGILSAQSQVKALRKHGFRTFSLSHVFEMPKTVWRSVPKQMKIGEVFNKNVIYHKSG QYLVEKDDKSFFVVKTTETNIECKDPKCASKPAITCSHVFAVLSTLPTKKCQEVLNIREKFLISLSRSLQIKSINDGKDA KRYPNRKYSKRSHNNGGRTVSEFKKVNRNVSGESESGDDERKADGNISSDEENDSDCDVNSLNSKPNVFDESGDIVEDEI SCNSNDEHVNLVLDPSVDHLNSHDSCMDLSDDPRKYDSDSDEENDIFGYQNVNPVPKPSNRVSNDHSSQIDLRDVLGEKG SRKPESDSEEVTDVSTGQHVKPMSLKEKFPIGYMHRLSDDSDDSET >gi| |emb|CAE | Hypothetical protein CBG25084 [Caenorhabditis briggsae] MRFFFLLHILLMLHHFISHLLIQRAACGAHIADQVLEIMPFFDQHTELLSIHSVGPWRISFLISSVFSFFFFSAAFIFST FLKVASPPEATADQKSRLDMLVQKVLNVGIDSKAQIQERTKEKVGKVMKETEEIKGKFMDIKKFTLADKRGKPIKEELEM EKKKRQMLLDEIKRLGEAKEEMSNDDDEPFENLMKEIDKLFEEADENRKLQKEADKEIATAATRQDAVFNEEMEEIEKFL SDIRNADKLQL >gi| |emb|CAE | Hypothetical protein CBG25082 [Caenorhabditis briggsae] EFQNFRKTHKNSEFRNFRNLETQGSEKSEFQISGFRFQILYFRFQISDFRFQISDFRFQISDFRFQISDFRFQISDFRFQ ISDQISDFGEENVEASFYLSLKIFSEFQISGFQNFRKTHKNSEFRNFRNLETQGSEKFQISDFIFQISDFRFQISDFRFQ ISDFRFQISDFRFQISDFRFQISDFRFQISDFRFQISDQISDFGEENVEASFYLSLK >gi| |emb|CAE | Hypothetical protein CBG25081 [Caenorhabditis briggsae] MYSWTRSRYWLTRSMWRWIQSRYSWWTRSMYSWTRSRWRWIQSRYSWTRSRYSLTRSMWRWIQSRYLWTRSRYSWTRSMW RWIQSMYSWTRSRWRWIQSRYSWTRSRYSLTRSKWRWIQSRYSWTRSRYSWTRSMWRWIQSRYSWTRSRYSWTRSMWRWI QLRYSWTRSRYSLTRSRWRWIQSMYSWTRSRWRWIQSMYSWTQSRWRWIQSRYSWTRSRYSLTRSMWRWIQSRYSWTRSR YWLTRSMCRWIQSRYLWTRSRYSWTRSRWRWIQSRYSWTRSRWRWIQSRYSWTRSRYSWTRSKCRWIQSRYSWTRSRYSW TRSMWRWIQLRYSWTRSRYSWTRSMWRWIQSRYLWTRSRYSWTRSMWRWIQSMYSWTRSRWRWIQSRYSWTRSRYSLTRS KWRWIQSRYSWTRS >gi| |emb|CAE | Hypothetical protein CBG24048 [Caenorhabditis briggsae] GLTEYVTVMACIVVDAEPIFGAIYRPFFNETIFGLQGFGVVTSDGKKISPVDEGKTDKKVVVSRSHAGKVKEIVEKVYGD KMTIEAAGGSGYKTLRLVNGTAGKGNKYIF >gi| |emb|CAE | Hypothetical protein CBG25080 [Caenorhabditis briggsae] TKPNPQNMLIGKQKKAKAEGYDTNSLAIHSKVNASDFIKSSGYLDILGEANVILLDDPKWKNHEKTTEEVVEYMKDVKVL GPRELRVLLRWRKSMLETLEAERKAVEGEAQDVEIEEDLTEEQIEDRAMAEIDELIAKASEDEKAALKKKKKKMLKAKAR VLKRRELKMIIDGDEGPQAEDQEVFQLKKIRKAKELAEITKETQAPDFENVEGKGAGWRGWGGREWLYLEISLFSAVF >gi| |emb|CAE | Hypothetical protein CBG25077 [Caenorhabditis briggsae] MWAEPHHRISELFQNFRISESQNLRISESQNLRISESQNLRISESQNLRISESQNLRISESQNLRISESQNLRISESQNL RISESQNLRISESQNLRISESQNLRISESQNLRISESQNLRISESQNLRISESQNLRISESQNLRISESQNLRISEFQNL RISESQNLRISEFQNLRISESQNLRISESQNLRISESQNLRISESQNLRISESQNLRISEFQNF >gi| |emb|CAE | Hypothetical protein CBG23749 [Caenorhabditis briggsae] MPNRERYVKKFTVEQKRKMDEVFVASRNPEKGKIAALVAELELTTTQVRQYFRKQRFKNPIPEEIPRFLSEEQVEHGIVD GETFKRERNSEKRNQFEDAMEKFFEERQFLEEPDETLELESGGSRKRISDWLDKKRYDTLKSFLEKEISVLPNEMATFEK LSEKYCLDTTTHPDVILYIEMKED >gi| |emb|CAE | Hypothetical protein CBG25076 [Caenorhabditis briggsae] GNFHNYVCSVNGTSPDPRYKRFINFSKKLRNCGIQVTMAQMFMFQKDENSFLDYNKERSPYFKFSEICITDWEKFWKKLL QFSCSLAGYSSSHLAFYSHDLARKVLKI >gi| |emb|CAE | Hypothetical protein CBG25074 [Caenorhabditis briggsae] NGGYSHRSTLSRDLPSEETITSITPFDEEKLSDDSIDQSAQEISHSSKTDDMSDEKMSGVSISPIDPDESIQLTLPNEQE ASRSSITEGIAEEMLPVDPIGTVAQGESVPSFPPTSFSDTIAQLRLYFNQELSNEGAMPAVSADRAIHSAKRTSSVPIRQ YSSDTVDENELAVKKPRFFSPQRQVLKPLNTSYKLAMSPEAPSSEHPNSLVEPLVVLQKSPEEPWAELLNRPKTQTLPEA LQQLRPLKRYGKQVTLKEYLQIQFKGQLLRTIDWNRVDDLKLFHPKTALFQSTNHPILLLAGKSFNRALLVEGNHRTAAL SECHAQKELSDDDLKSTVPLTFFQIPKPEFNNMWMAANELGRQVQAQARFDWKNASSRTREAVFSEFKKEAYRTKGKFSK FESSIL >gi| |emb|CAE | Hypothetical protein CBG25073 [Caenorhabditis briggsae] MVLYQMTLFFSVQMLFAIFLEYMPKTYCTDDDYCYKMKNKCLTDFIREDDSQICPYNSTDFKQCVLDAKRVDFRSAQFDY QQDCTGLKHFSSSTATFIGTLLGNLVLIYLSDTIGRRPVFIFSIALGVPALILSAAINGVMNFYIFRFIVGFAVAGTLTV GWTYSSEMITPSRRFRLRTFPNWA >gi| |emb|CAE | Hypothetical protein CBG25071 [Caenorhabditis briggsae] MAFIFSTGYQMAFMQYGMTTIITLNRLTVLLNFTFFEPIWKKYSWLLVIFLIFLPFLSTKVALNYDSKFSYQNSTDYFLL TSGMPVWEIYSILIPFMIVTIVTSLAANLSSFVFVKHRKLVMAYKA >gi| |emb|CAE | Hypothetical protein CBG25072 [Caenorhabditis briggsae] ITSITLIIQVIGNFLSIGMLTFEHSDYLPYLSIIRPFVSDGLTLVQPWLLYFFSSPMRKKLQQMFKRSSPATVATVVFKS RSV >gi| |emb|CAE | Hypothetical protein CBG25067 [Caenorhabditis briggsae] MYGLGFVVNSAKLANARSLWFNVGALNHLHRTWSLGQGVVFSRAVLLSCDLLRLSFD >gi| |emb|CAE | Hypothetical protein CBG24068 [Caenorhabditis briggsae] MKKITESGIRNPEISGFKNGSYPRTQVIATMVIPGNMPSAFPFFLTFKLVSSCSTSSFFHKSLGNLNFRSKSVTMAKGNI FVRFKNYIVETISDTYHHIRELRAEWNRQQGRG >gi| |emb|CAE | Hypothetical protein CBG25066 [Caenorhabditis briggsae] SPFKDEAVFRFSNWFKKLGDEDKDKEAEEKEKELAEIAETRFLENKQKFRSLLIERKFSAEEWTLMKQFLDYPELAAIVV KMRRSQGVPGLRQNRRRCLTCEESLAGMPLTAHKTENCSIPYESRILVSKRLFGQRKCYGCGRMKEDGNCNCKSVPCRRC WRWNVPESFPHLQVMGTCQMVWKIRQETGHVPTEHEISDYTKRNDKIASIIQHKLEKFVAETERELVDAGRASNQKTEAE LWWVADKYRTLAFSIPWHGAKGYFRKISKLFESPETI >gi| |emb|CAE | Hypothetical protein CBG24269 [Caenorhabditis briggsae] MIEAVDRILVVDASIVTDTSIQKENLISSSLNQHGEINFVIETCDQYLHLHKSYIYLEVDLSKLDDTALAETDEVSLTNN APMFLFDRATYSMDGVQVENIWILVELV >gi| |emb|CAE | Hypothetical protein CBG25062 [Caenorhabditis briggsae] VLQTDESGNYIYPAVGPDGQVLPTDATGKTVYPVRGPDGTPLPTDASGAVIGPDGEPIPTDASGKPLSQDGSPLPTDNQG NYVLVPTGEDVTKYLPTDESGNVIYPITRPDGTPLGTDASGNFVTDDGTVVEKDDEGKPVGPDGAVLPTDASGNYIYPVV GPDGQVLPTDATGKTVYPVRGPDGTPLPTDGSGAVIGPDGEPIPTDPSGKPLSKDGSPLPTDASGNYILVPAEEETTKTL PTDSEGNVIYPITNPDGTPLGTDSSGAFVTQDGTVIEKNEDGKPVGPDGQFVYSVIADIFFPYLQNQGPVLQISKKN >gi| |emb|CAE | Hypothetical protein CBG25061 [Caenorhabditis briggsae] MGMKWTGLTFEIAAEEMRRLKSTPSEREQMKLYGLYKQALHGDIPNEDVYPVSQKEKQSLEPEKSSALAERVYLTN >gi| |emb|CAE | Hypothetical protein CBG24622 [Caenorhabditis briggsae] SSFFGMLVYCVRVCMYVNDTEKEGEREELSMSYNQKRYTPKRRRNEIDDMMNAGQMAVGSSGTIAMGTGVPQKKDDMDAL STLERDVAKRTQHAQQILLRQRANQSTPRSVTPPPQPQEFKTYVISAPQQQHQQHVGNNGHQQVLHGGHMQQQQQIQVSH QEIMSEKAKFGSANVARVSLRLHWPAKYLADHFFV NO MATCH! Csorba Attila esettanulmánya az adatbázisokkal

3 ZULU

4 ZULU Célpont: Capsicum annuum kitinázaktivitást mutató fehérjéi, aktivitásfestés alapján, 1D SDS-PAGE gélcsíkok, (Ca1, Ca2, Ca3, Ca4, Ca5, 32  20kDa) Probléma: Capsicum annuum, alias paprika A fehérjeadatbázis defektív az alanyra nézve. Bizonyítás: Capsicum annuum vs. Oryza sativa (paprikakontrarizs) Fehérjetalálatok száma az NCBInr i adatbázisban:

5 Célpont: Capsicum annuum kitinázaktivitást mutató fehérjéi, aktivitásfestés alapján, 1D SDS-PAGE gélcsíkok, (Ca1, Ca2, Ca3, Ca4, Ca5, 32  20kDa) Probléma: Capsicum annuum, alias paprika A fehérjeadatbázis defektív az alanyra nézve. Bizonyítás: Capsicum annuum vs. Oryza sativa (paprikakontrarizs) Fehérjetalálatok száma az NCBInr i adatbázisban: >3.5 millió (6× mol)

6 Felszerelés: BBruker Reflex III, MALDI-TOF nagy felbontás (>10000), pontosság (∆m<200ppm), szimpla minták jó azonosíthatósága (PSD) AAgilent 1100 series, LC/MSD Trap, HPLC-oszlop: Zorbax 300SB-C18, 3.5µm, 150mm×75µm komplex minták könnyű azonosítása, nagyszámú MS/MS adat Stratégia: MALDI-TOF: PMF Nincs/kevés fehérje PMF-lekeresés PSD alátámasztás Gotcha! Komplex minta és/vagy defektív adatbázis Sikeresség Komplex minta és/vagy defektív adatbázis LC-MS/MS? Eredményesség A spektrum minősége   

7 B-terv: LC-MS/MS Nincs/kevés fehérje MS/MS lekeresés Gotcha!Defektív adatbázis Homológia keresés (BLAST) Manuális szekvenálás  Saját adatbázis létrhozása  nonredundáns PDB MS/MS információ  

8 B-terv: LC-MS/MS Nincs/kevés fehérje MS/MS lekeresés Gotcha!Defektív adatbázis Homológia keresés (BLAST) Manuális szekvenálás  Saját adatbázis létrhozása  nonredundáns PDB MS/MS információ  

9 Mission possible ?!

10

11 MALDI-TOF, Ca1: PDB lekeresés: 1. gi| peroxidase POA1 [Capsicum annuum] 2. gi| peroxidase [Capsicum annuum] 1.2. Mi a különbség a szekvenciák között?

12 Akkor most melyik? Válasz: PSD analízis! Ca1: Lefedettségi térkép, szekvenciák összehasonítása RVGFYS STCPRAESIV QSTVRSHFQS DPTVAPGLLR MHFHDCFVQG CDASILISGS GTERTAPPNS LLRGYEVIDD AKQQIEAICP GVVSCADILA LAARDSVVVT RGLTWSVPTG RRDGLVSRAS DTSDLPGFTE SVDSQKQKFS AKGLNTQDLV TLVGGHTIGT SACQFFSYRL YNFNSTGGPD PSIDASFLPT LRGLCPQNGD GSKRVALDTG SVNNFGTSYF SNLRNGRGIL ESDQKLWTDD STKVFIQRYL GLRGFLGLRF GVEFGRSMVK MSNIEVKTGT NGEIRKVCS 1. gi| MEYYYNYNSI NKMVSIIFIL VLAIDLTMVL GQGTRVGFYS STCPRAESIV QSTVRSHFQS DPTVAPGLLT MHFHDCFVQG CDASILISGS GTERTAPPNS LLRGYEVIDD AKQQIEAICP GVVSCADILA LAARDSVLVT KGLTWSVPTG RRDGLVSRAS DTSDLPGFTE SVDSQKQKFS AKGLNTQDLV TLVGGHTIGT SACQFFSYRL YNFNSTGGPD PSIDASFLPT LRGLCPQNGD GSKRVALDTG SVNNFDTSYF SNLRNGRGIL ESDQKLWTDD STKVFIQRYL GLRGFLGLRF GVEFGRSMVK MSNIEVKTGT NGEIRKVCSA IN 2. gi|

13 Ca1: PSD analízis, m/z: 1624,85 1. m/z: 1624,85 b-ionok \\\\\ SHFQSDPTVAPGLLR \\ \ y-ionok MALDI-TOF alapján az erős homológia ellenére: 1. gi| peroxidase POA1 [Capsicum annuum]

14 Ca2: Ca5:Ca4: Ca3:

15 Ca2: SpeciesProtein Name 1TOXOPLASMA GONDIIcasein kinase I beta isoform 2BORDETELLA PARAPERTUSSISLysR-family transcriptional regulator 3LISTERIA MONOCYTOGENES STR. 4B F2365oxidoreductase, Gfo/Idh/MocA family 4LISTERIA MONOCYTOGENES STR. 4B H7858oxidoreductase, Gfo/Idh/MocA family 5AGROBACTERIUM TUMEFACIENS STR. C58AGR_L_644p 6BURKHOLDERIA PSEUDOMALLEI 1710ACOG1562: Phytoene/squalene synthetase 7BURKHOLDERIA PSEUDOMALLEI S13COG1562: Phytoene/squalene synthetase 8BURKHOLDERIA PSEUDOMALLEI 1655COG1562: Phytoene/squalene synthetase 9BURKHOLDERIA PSEUDOMALLEI 668COG1562: Phytoene/squalene synthetase 10BURKHOLDERIA MALLEI NCTC 10247COG1562: Phytoene/squalene synthetase 11BURKHOLDERIA PSEUDOMALLEI K96243putative squalene/phytoene synthase 12BURKHOLDERIA MALLEI ATCC 23344squalene/phytoene synthase family protein 13SOLIBACTER USITATUS ELLIN6076von Willebrand factor, type A 14BURKHOLDERIA PSEUDOMALLEI 1710Bsqualene/phytoene synthase family protein 15CAENORHABDITIS BRIGGSAEHypothetical protein CBG CRYPTOSPORIDIUM PARVUMheat shock protein 60 17CLOSTRIDIUM BEIJERINCKI NCIMB 8052glucuronate isomerase 18UNREADABLEgi|606946|gb|AAA | neural-restrictive silencer factor 19MYCOPLASMA CAPRICOLUM SUBSP. CAPRICOLUM ATCC 27343N utilization substance protein B (nusB), putative 20PLASMODIUM BERGHEI STRAIN ANKADNA-directed RNA polymerase II

16 Ca3: SpeciesProtein Name 1MUS MUSCULUSadenylate kinase 3 2PSEUDOMONAS SYRINGAE PV. PHASEOLICOLA 1448Aexopolysaccharide biosythesis protein 3CHLOROFLEXUS AURANTIACUS J-10-FL Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA dehydrogenase, central region:Acyl-CoA dehydrogenase, central region 4LEGIONELLA PNEUMOPHILA STR. LENShypothetical protein 5ERYTHROBACTER LITORALIS HTCC2594ribosomal protein L10 6ARABIDOPSIS THALIANAAT4g22240/T10I14_70 7NOSTOC SP. PCC 7120alr3497 8LEISHMANIA MAJORhypothetical protein, unknown function 9PROCHLOROCOCCUS MARINUS STR. MIT 9211rubredoxin 10CAENORHABDITIS ELEGANSHypothetical protein C52E2.5 11CANIS FAMILIARIS PREDICTED: similar to C-type lectin domain family 14, member A 12HERBASPIRILLUM SP. B501nitrogenase Mo-Fe protein alpha chain 13ORYZA SATIVA (JAPONICA CULTIVAR-GROUP)myb family protein-like 14DANIO RERIOhypothetical protein LOC LEGIONELLA PNEUMOPHILA STR. LENShypothetical protein 16DANIO RERIOT-cell receptor gamma 17METHYLOBACILLUS FLAGELLATUS KTProtein of unknown function DUF ASHBYA GOSSYPII ATCC 10895ACL096Wp 19ANOPHELES GAMBIAE STR. PESTENSANGP DEBARYOMYCES HANSENII CBS767unnamed protein product

17 Ca4:

18 Ca5: SpeciesProtein Name 1VARIOLA VIRUSA18R 2VARIOLA MINOR VIRUSA19R protein 3DANIO RERIOhypothetical protein LOC DROSOPHILA MELANOGASTERCG33455-PA 5DESULFITOBACTERIUM HAFNIENSE DCB-2Helix-turn-helix, Fis-type 6HAHELLA CHEJUENSIS KCTC 2396ABC-type uncharacterized transport system, ATPase component 7AZOARCUS SP. EBN1putative membrane-bound regulator HflC 8HUMAN IMMUNODEFICIENCY VIRUS TYPE 1envelope glycoprotein 9NICOTIANA TABACUMNtPRp27 10RATTUS NORVEGICUSPREDICTED: similar to BC protein 11XENOPUS LAEVISMGC84728 protein 12RHODOPSEUDOMONAS PALUSTRIS HAA2transcriptional regulator, GntR family 13SILICIBACTER POMEROYI DSS-3choline sulfatase, putative 14 XANTHOMONAS AXONOPODIS PV. CITRI STR. 306 phosphoenolpyruvate carboxylase 15MUS CAROLIeosinophil-associated ribonuclease 2 precursor 16HELICOBACTER HEPATICUS ATCC 51449glutamyl-tRNA synthetase 17ORYZA SATIVA (JAPONICA CULTIVAR-GROUP) putative eukaryotic initiation factor (iso)4F subunit p82-34 (eIF-(iso)4F p82- 34) 18XENOPUS LAEVISXrcc1-prov protein 19PLASMODIUM YOELII YOELII STR. 17XNLhypothetical protein PY DANIO RERIOPREDICTED: hypothetical protein XP_696923

19 MALDI-TOF összefoglalás: Ca1: PSD-vel igazolt paprikafehérje Ca2, Ca3, Ca4, Ca5: A lekeresések eredménye nem bíztató, PSD analízisre alkalmatlan minták Ca2, Ca5: Gyenge spektrumok Ca3, Ca4: Túl komplex minták B-terv: LC-MS/MS

20 LC-MS/MS eredmények az NCBInr adatbázisából: Protein MW (Da)SpeciesProtein Name Atropa belladonnaputative NtPRp27-like protein 21400Capsicum annuumleucine-rich repeat protein Capsicum annuumchitinase class II 31873Capsicum annuumperoxidase POA Capsicum annuumperoxidase Lycopersicon esculentumchitinase Lycopersicon esculentumperoxidase Lycopersicon esculentumperoxidase Lycopersicon esculentumLEXYL Nicotiana tabacumputative basal resistance related chitinase 27378Nicotiana tabacumNtPRp Oryza sativa (indica cultivar-group)PR-3 class IV chitinase Oryza sativa (japonica cultivar- group)OSJNBb0091E Solanum chacoense triose phosphate isomerase cytosolic isoform Solanum tuberosumNtPRp27-like protein

21 Egy kis növényrendszertan: Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliophyta Eudicotyledons Core Eudicotyledons Asterids Lamiids Solanales Solanaceae Solanum Solanum tuberosum Solanum chacoense Lycopersicon esculentum Capsicum Capsicum annuum Nicotiana Nicotiana tabacum Atropa Atropa belladonna Liliopsida Commelinids Poales Poaceae Ehrhartoideae Oryzeae Oryza Oryza sativa

22 tBLASTn:TIGR adatbázis (genom adatbázis, 6 frame fordítás)

23

24

25

26

27

28

29

30

31 SpeciesProtein Name Capsicum annuum TC3404 ORF frame +1 homologue to Q6T379 Triose phosphate isomerase cytosolic isoform- complete Capsicum annuum TC3587 ORF frame +1 homologue to CHIB_LYCES Q05540 cidic 27 kDa endochitinase precursor- part Capsicum annuumTC3666 ORF frame +1 similar to Q7XB39 Class IV chitinase- partial Capsicum annuumTC3667 ORF frame +3 similar to Q43151 Pathogenesis-related protein- PR-3 Capsicum annuumTC3709 ORF frame +3 Q8W4V8 Peroxidase- complete Capsicum annuumTC4206 ORF frame +3 homologue to O82552 Chitinase class II- partial Capsicum annuumTC4719 ORF frame +2 homologue to Q84XQ4 NtPRp27-like protein- partial Capsicum annuumTC5120 ORF frame +2 O82552 Chitinase class II- complete Capsicum annuum TC6065 ORF frame +1 similar to PERX_NICSY Q022 Lignin forming anionic peroxidase precursor – partial

32 Mission completed


Letölteni ppt "A publikus adatbázisból hiányzó fehérjék azonosítási lehetõségei >gi|39578743|emb|CAE57166.1| Hypothetical protein CBG25105 [Caenorhabditis briggsae] MTIASKERRCARLLTQSDATSYFEKYKRVRSTDMKVQQCQSVAFNCDGTKLVCGAFDKKVSIANVDGGRLRFSWVGSSHT."

Hasonló előadás


Google Hirdetések