Az előadás letöltése folymat van. Kérjük, várjon

Az előadás letöltése folymat van. Kérjük, várjon

P P P Thr Tyr CDK ciklin CKI 1. Kölcsönhatás ciklinekkel 3. Gátló foszforiláció 2. Aktíváló foszforiláció 4. Kölcsönhatás Cdk gátlókkal A Cdk aktivitást.

Hasonló előadás


Az előadások a következő témára: "P P P Thr Tyr CDK ciklin CKI 1. Kölcsönhatás ciklinekkel 3. Gátló foszforiláció 2. Aktíváló foszforiláció 4. Kölcsönhatás Cdk gátlókkal A Cdk aktivitást."— Előadás másolata:

1

2 P P P Thr Tyr CDK ciklin CKI 1. Kölcsönhatás ciklinekkel 3. Gátló foszforiláció 2. Aktíváló foszforiláció 4. Kölcsönhatás Cdk gátlókkal A Cdk aktivitást négyféle molekuláris mechanizmus szabályozza

3 ciklin A ciklin B ribonukleotid reduktáz MPF ciklin mitózis interfázis relatív koncentráció A ciklinek és az MPF koncentrációja párhozamosan változik a sejtciklus folyamán változik a sejtciklus folyamán Ruderman és Hunt kísérlete

4 H2NH2N COOH Cyclin A Cyclin B1 Cyclin B2 Arg – Thr – Val – Leu – Gly – Val – Ile – Gly - Asp Arg – Thr – Ala – Leu – Gly – Asp – Ile – Gly - Asn Arg – Ala – Ala – Leu – Gly – Glu – Ile – Gly - Asn ciklin kazetta Minden mitótikus ciklin hordoz egy 9 aminósavból álló, evolúciósan konzerválódott destrukciós kazettát

5 Ubiquitin  76 aminósavból álló polipeptid  csak eukariótákban található  evolúciósan konzerválódott  poliproteinként szintetizálódik  hőstabil globuláris struktúrája van  szabadon és proteinekhez konjugáltan fordul elő  proteineken degradációs jelként funkcionál lizin oldallánchoz kötődés helye hidrofób mag

6 1-MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIF-45 1-MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF-45 1-MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF AGKQLEDGRTLSDYNIQKESTLHLVLRLRGG AGKQLEDGRTLADYNIQKESTLHLVLRLRGG AGKQLEDGRTLSDYNIQKESTLHLVLRLRGG-76 Fission yeast human Green pea fruitfly The structure of ubiquitin is conserved from yeast to human

7 Az ubiquitin poliproteinként szintetizálódik Ubiquitin UbiquitinUbiquitinUbiquitin Ribosomal protein Transzkripció/Transzláció Ub C-terminális hidroláz Ub UbUb Ub

8 "for the discovery of ubiquitin-mediated protein degradation" Nobel prize in chemistry, 2004 Aaron Ciechanover Avram Hershko Irwin Rose Aaron Ciechanover Avram Hershko Irwin Rose

9 Az Ubiquitin-függő fehérjelebontás mechanizmusa Protein Protein Ub Ub Ub Ub Ub Ub Ub Ub

10 Az SCF komplex felépítése

11 Az APC/C felépítése Sejtciklus szabályozott ubiquitin protein ligáz Sejtciklus szabályozott ubiquitin protein ligáz Mitótikus ciklinek és anafázist gátló fehérjék lebontását koordinálja Mitótikus ciklinek és anafázist gátló fehérjék lebontását koordinálja A sejtciklus M és G1 fázisaiban aktív A sejtciklus M és G1 fázisaiban aktív Többalegységes komplex, amelynek Többalegységes komplex, amelynek tömege > 1,500 kDa Az egyes alegységek nagyfokú evolúciós konzerváltságot mutatnak Az egyes alegységek nagyfokú evolúciós konzerváltságot mutatnak

12

13 APC alegységeket kódoló Drosophila gének Budding yeast genes APC1APC2CDC27APC4APC5CDC16---CDC23APC9APC10APC11 Drosophila homologs CG9198 – shattered - CG3060 – morula - CG8610 – mákos - CG32707 CG10850 – ida - CG6759 CG APC7 - CG CG11419 CG18042 – lemming -

14 Az APC és SCF komplexek struktúrálisan hasonló alegységeket tartalmaznak Skp1 Cul1 F-box Rbx1Cdc34 Apc2 Fizzy Apc11Ubc2 SCFAPC

15 APC-dependent degradation of different cell cycle regulatory proteins APC CDC20 metaphase anaphase Mitotic exit G1 S cycAcycA APC CDH1 Nek2Nek2 cycBcycB XkidXkid SecurinSecurin Kip1Kip1 Cin8Cin8 cycBcycB Plk1Plk1 Ase1Ase1 Tome-1Tome-1 Aur-AAur-A Orc1Orc1 Cdc6Cdc6 GemininGemininCDC20CDC20

16 APC GÁTLÁSA NEM DEGRADÁLHATÓ M-CIKLIN metafázisgátlásanafázisgátlás A ciklineken kívül egy anafázist gátló fehérje degradációja is szükséges a kromoszóma szeparációhoz

17 inaktív APC Cdc20 aktív APC szekurin inaktív szeparáz kohézin komplex aktív szeparáz szekurin degradálódása hasított kohézin A kromoszóma szeparációt protein degradáció indukálja G2 metafázisanafázis

18 APC controls entry into anaphase and exit from mitosis

19 Proteaszóma „the cellular chamber of doom”  Composed of 43 subunits with a molecular mass of about 2500 kD  Tunnel-like 20S catalytic core particle  Two 19S regulatory cap particles  Major substrates: polyubiquitinated proteins  Cleaves proteins in an ATP dependent manner

20 Sejtciklus szabályozása DNS-hiba javítás Tumorgenezis Fehérje minőségellenőrzés Antigén processzálás Riboszóma Biogenezis Transzkripció Vírus fertőzés Vírus fertőzés Ideg és izomdegeneráció Sejtdifferenciáció Stressz válasz Az ubiquitin-függő proteolitikus rendszer számos sejtfolyamat szabályozásában vesz részt

21 Human pathologies resulting from disorders in protein degradation

22 Parkinson disease synucleinsynuclein parkin parkin Dopamine producing cells die

23 von Hippel-Lindau syndrome Caused by mutation of the VHL tumor szupressor gene. Caused by mutation of the VHL tumor szupressor gene. This leads to the development of angio-blastoma in the CNS and the retina. This leads to the development of angio-blastoma in the CNS and the retina. Also leads to the development of cysts in kidneys and renal cell carcinoma. Also leads to the development of cysts in kidneys and renal cell carcinoma.

24 HIF VHL oxigén The VHL protein regulates the degradation of the HIF transcription factor

25 Mutation of the VHL gene leads to overproduction of growth factors HIFHIF VHL VEGF TGF-α Growth factors angiogenezis Tissue overgrowth

26 mitózis befejezése metafázis- anafázis átmenet metafázis anafázis citokinézis Anafázist gátló fehérje Ub Anafázist gátló fehérje Ciklin B Ub Ciklin B APC F APC FR


Letölteni ppt "P P P Thr Tyr CDK ciklin CKI 1. Kölcsönhatás ciklinekkel 3. Gátló foszforiláció 2. Aktíváló foszforiláció 4. Kölcsönhatás Cdk gátlókkal A Cdk aktivitást."

Hasonló előadás


Google Hirdetések