Az előadás letöltése folymat van. Kérjük, várjon

Az előadás letöltése folymat van. Kérjük, várjon

EScience Régionális Egyetemi Tudásközpont Projekt neve: Genom-annotáció Projekt vezető: Patthy László Partner cég:DELTA Elektronik Kft. eScience Tudományos.

Hasonló előadás


Az előadások a következő témára: "EScience Régionális Egyetemi Tudásközpont Projekt neve: Genom-annotáció Projekt vezető: Patthy László Partner cég:DELTA Elektronik Kft. eScience Tudományos."— Előadás másolata:

1 eScience Régionális Egyetemi Tudásközpont Projekt neve: Genom-annotáció Projekt vezető: Patthy László Partner cég:DELTA Elektronik Kft. eScience Tudományos Nap Budapest, február 27

2 A jelenleg használatos gyógyszerek kevesebb mint 500 humán célfehérjére hatnak. A Humán Genom Projekt egyik fontos motivációja az volt, hogy a teljes genom-szekvencia meghatározása révén azonosítani lehessen a teljes humán génkészletet és a sokezer, korábban nem ismert gén közül ki lehessen választani azokat, amelyek új gyógyszercélpontként szolgálhatnak.

3 Egy új-típusú gyógyszer kifejlesztése általában évet vesz igénybe és átlagosan millió USA dollárba kerül. A gyógyszerfejlesztés igen gyakran sokévi kutatómunka (és sok millió USD) invesztálását követően fullad kudarcba, így rendkívül fontos a gyógyszercélpont megfelelő kiválasztása CÉLFEHÉRJÉK AZONOSÍTÁSA AKTÍV VEGYÜLETEK AZONOSÍTÁSA ÉS OPTIMALIZÁLÁSA PRE- KLINIKAI VIZSGÁLATOK KLINIKAI VOZSGÁLATOK ENGEDÉ- LYEZÉS FÁZIS IIFÁZIS IIIFÁZIS I GYÓGYSZER BETEGSÉG OKAINAK TISZTÁZÁSA ÉV CÉLFEHÉRJÉK VALIDÁLÁSA

4 A ‘genotypic drug discovery’a genom-annotáció és a funkcionális genomika eszköztárát alkalmazza annak érdekében, hogy a genomban azonosított gének által kódolt fehérjék funkcióját, biológiai szerepét és betegségek kialakulásában játszott szerepét meghatározza és kiválassza azokat, melyek alkalmasak gyógyszer-célpontnak.

5 A genom-szekvencia értelmezésének, a genom annotációnak, első és alapvető lépése a gének bioinformatikai úton történő azonosítása. A génazonosítás még mindig meglévő problémáit illusztrálhatjuk azzal, hogy 5 évvel az emberi genom szekvenciájának meghatározása után még mindig bizonytalan ( közé tehető) az emberi genomban található fehérje-kódoló gének száma.

6 Ennél is súlyosabb problémát jelent, hogy az azonosított gének jelentős hányadának (cca. 50 %- ának) a bioinformatikai módszerekkel megjósolt szerkezete téves. A jelenlegi génpredikciós módszerek jelentős bizonytalansága így komoly problémákat okoz a (tévesen) megjósolt gének/fehérjék funkciójának meghatározásában, gyógyszercélpontként való hasznosíthatóságuk megítélésében.

7 Az eScience Régionális Egyetemi Tudásközpont „Genom-annotáció” projektjének célkitűzése: - a jelenleg alkalmazott génpredikciós módszerek hibáinak kiderítése, a hibásan megjósolt gének azonosítása. - megbízhatóbb génpredikciós eljárások kidolgozása. - a rosszul predikált humán gének helyes szerkezetének meghatározása, funkciójának predikciója és a gyógyszercélpontként felhasználható gének azonosítása.

8 A tévesen megjósolt szerkezetű és/vagy abnormális fehérjék azonosítására szolgáló MisPred projekt alapja az az általános megfontolás, hogy egy fehérje-kódoló gén megjósolt szerkezete téves, ha a jósolt gén és/vagy fehérje valamely tulajdonsága nem egyeztethető össze a fehérjekódoló génekre és/vagy fehérjékre jellemző törvényszerűségek valamelyikével.

9 A MisPred projekt jelenlegi verziója öt szabályt alkalmazott különböző élőlények hibás fehérjéinek azonosítására az EnsEMBL, UniProt Swiss-Prot és UniProt TrEMBL adatbázisokban.

10 1. Konfliktus a fehérje szubcelluláris lokalizációja és a lokalizációs jelek megléte vagy hiánya között. Szabály: azok a fehérjék, melyek az extracelluláris térre korlátozott fehérjedoméneket tartalmaznak (pl. szekretált fehérjék, membránfehérjék) szignál peptidet és/vagy transzmembrán szegmentet is kell, hogy tartalmazzanak. Másszóval, azok a fehérjék, melyek extracelluláris doméneket tartalmaznak, de sem szignál peptidjük, sem transzmembrán szegmentjük nincs, abnormálisnak tekinthetők. latrophilin-2 SP complement factor masp-3 SP leukocyte activation antigen m6 SPTM killer cell lectin-like receptor TM receptor tyrosine kinase-like orphan receptor 2 TM SP

11 enst pep UNI_TREMBL:Q8N708 ID Q8N708 PRELIMINARY; PRT; 449 AA. AC Q8N708; DT 01-OCT-2002 (TrEMBLrel. 22, Created) DT 01-OCT-2002 (TrEMBLrel. 22, Last sequence update) DT 01-MAR-2003 (TrEMBLrel. 23, Last annotation update) DE HF1 protein.... SCORES Init1: 3167 Initn: 3167 Opt: 3167 z-score: E(): 1.1e-195 >>UNI_TREMBL:Q8N708 (449 aa) initn: 3167 init1: 3167 opt: 3167 Z-score: expect(): 1.1e-195 Smith-Waterman score: 3167; 99.5% identity in 430 aa overlap (1-430:20-449) enst DCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLG ||||||||||||||||||||||||||||||||||||||||| Q8N708 MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLG enst NVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Q8N708 NVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQL enst LGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Q8N708 LGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNS enst GYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Q8N708 GYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMG enst YEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYP |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Q8N708 YEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYP enst ATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Q8N708 ATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEH enst FETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGY |||||||||||||||||||||||||||||||||||||||||:|||||||||||||||||| Q8N708 FETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGY enst ALPKAQTTVTCMENGWSPTPRCIRVKFTL |||||||||||||||||||||||||:||| Q8N708 ALPKAQTTVTCMENGWSPTPRCIRVSFTL

12 Q8N708 ENSP Szignál peptid

13 2. Konfliktus. Extracelluláris és intracelluláris domének együttes jelenléte és transzmembrán szegmentek hiánya. Szabály: extracelluláris és intracelluláris domének multidomén fehérjékben csak akkor fordulhatnak együtt elő, ha transzmembrán szegmentek választják el egymástól a két domén típust. Másszóval, azok a fehérjék, melyek mind extracelluláris, mind intracelluláris doméneket tartalmaznak, de nem tartlmaznak transzmembrán szegmentet, abnormálisnak tekinthetők. receptor tyrosine kinase-like orphan receptor 2 TM SP KR

14 3. Konfliktus. Extracelluláris és nukleáris domének együttes előfordulása. Szabály: nukleáris és extracelluláris domének nem fordulnak elő egyetlen fehérjében. Másszóval, azok a fehérjék, melyek mind extracelluláris, mind nukleáris domént tartalmaznak abnormálisnak tekinthetők.

15 4. Konfliktus. Domén méret deviáció. Szabály: egy adott fehérje-domén családba tartozó domének mérete a családra jellemző, szűk határok között mozog. A domén méretének jelentős megváltozása (inszerció vagy deléció révén) nagy valószínűséggel olyan fehérjét eredményez, mely nem képes a domén-családra jellemző stabil térszerkezet kialakítására. Másszóval, azok fehérjék, melyek olyan doméneket tartalmaznak, melyek mérete lényegesen eltér a rokon doménekétől abnormálisnak tekinthetők.

16 Query= RP11-247A [544 aa] Subject= CACP_HUMAN, Carnitine O-acetyltransferase [626 residues] cacp_human MLAFAARTVV KPLGFLKPFS LMKASSRFKA HQDALPRLPV PPLQQSLDHY LKALQPIVSE EEWAHTKQLV DEFQASGGVG ERLQKGLERR ARKTENWLSE rp11-247a12 MLAFAARTVV KPLGFLKPFS LMKASSRFKA HQDALPRLPV PPLQQSLDHY LKALQPIVSE EEWAHTKQLV DEFQASGGVG ERLQKGLERR ARKTENWLSE cacp_human WWLKTAYLQY RQPVVIYSSP GVMLPKQDFV DLQGQLRFAA KLIEGVLDFK VMIDNETLPV EYLGGKPLCM NQYYQILSSC RVPGPKQDTV SNFSKTKKPP rp11-247a12 WWLKTAYLQY RQPVVIYSSP GVMLPKQDFV DLQGQLRFAA KLIEGVLDFK VMIDNETLPV EYLGGKPLCM NQYYQILSSC RVPGPKQDTV SNFSKTKKPP cacp_human THITVVHNYQ FFELDVYHSD GTPLTADQIF VQLEKIWNSS LQTNKEPVGI LTSNHRNSWA KAYNTLIKDK VNRDSVRSIQ KSIFTVCLDA TMPRVSEDVY rp11-247a12 THITVVHNYQ FFELDVYHSD GTPLTADQIF VQLEKIWNSS LQTNKEPVGI LTSNHRNSWA KAYNTLIKDK VNRDSVRSIQ cacp_human RSHVAGQMLH GGGSRLNSGN RWFDKTLQFI VAEDGSCGLV YEHAAAEGFP IVTLLDYVIE YTKKPELVRS PMVPLPMPKK LRFNITPEIK SDIEKAKQNL rp11-247a KKPELVRS PLVPLPMPKK LRFNITPEIK SDIEKAKQNL cacp_human SIMIQDLDIT VMVFHHFGKD FPKSEKLSPD AFIQMALQLA YYRIYGQACA TYESASLRMF HLGRTDTIRS ASMDSLTFVK AMDDSSVTEH QKVELLRKAV rp11-247a12 SIMIQDLDIT VMVFHHFGKD FPKSEKLSPD AFIQMALQLA YYRIYGQACA TYESASLRMF HLGRTDTIRS ASMDSLTFVK AMDDSSVTEH QKVELLRKAV cacp_human QAHRGYTDRA IRGEAFDRHL LGLKLQAIED LVSMPDIFMD TSYAIAMHFH LSTSQVPAKT DCVMFFGPVV PDGYGVCYNP MEAHINFSLS AYNSCAETNA rp11-247a12 QAHRGYTDRA IRGEAFDRHL LGLKLQAIED LVSMPDIFMD TSYAIAMHFH LSTSQVPAKT DCVMFFGPVV PDGYGVCYNP MEAHINFSLS AYNSCAETNA cacp_human ARLAHYLEKA LLDMRALLQS HPRAKL rp11-247a12 ARLAHYLEKA LLDMRALLQS HPRAKL deléció

17 STRUCTURE OF HUMAN CARNITINE ACETYLTRANSFERASE 1NM8.pdb His 343 A Carnitine O-acetyltransferase térszekezete

18 5. Konfliktus. Kimérikus fehérjék. Szabály: egy-egy fehérjét egyetlen kromoszómán található gén kódol. Másszóval, azok a fehérjék, melyek különböző részeit különböző kromoszómán található gének kódolják abnormálisnak tekinthetők.

19 A BioSapiens Network of Excellence, az Európai Virtuális Genom Annotációs Intézet feladatai között jelentős hangsúllyal szerepel a génpredikciós eljárások továbbfejlesztése.

20 Az ENCODE (the ENCyclopedia Of DNA Elements) projektet 2003-ban indította el a National Human Genome Research Institute, National Institute of Health azzal a céllal, hogy a humán genom valamennyi funkcionális elemét azonosítsa. Ehhez a projekthez a BioSapiens konzorcium tagjaként csoportunk is csatlakozott.

21

22

23 Az eScience Régionális Egyetemi Tudásközpont „Genom-annotáció” projektjének célkitűzése: - a jelenleg alkalmazott génpredikciós módszerek hibáinak kiderítése, a hibásan megjósolt gének azonosítása. - megbízhatóbb génpredikciós eljárások kidolgozása. - a rosszul predikált humán gének helyes szerkezetének meghatározása, funkciójának predikciója és a gyógyszercélpontként felhasználható gének azonosítása.

24 A munka a BioSapiens projekt és az eScience projekt keretében folyik. A BioSapiens projektet a European Commission finanszírozza a FP6 Program "Life sciences, genomics and biotechnology for health” téma keretében (szerződésszám: LHSG-CT ). Az eScience projektet az NKTH finanszírozza (RET14/2005). Balogh Sándor Keresztessy Attila Máris József Molnár Sándor Molnár Zoltán Oláh Zoltán Rákóczi Béla Szentgyörgyi Andor Szoboszlai Lajos Sztopen Erzsébet Szűcs Norbert Gulyás Ferenc Seffer Tamás Bányai László Farkas Krisztina Hegyi Hédi Kozma Evelin Nagy Alinda Tordai Hedvig


Letölteni ppt "EScience Régionális Egyetemi Tudásközpont Projekt neve: Genom-annotáció Projekt vezető: Patthy László Partner cég:DELTA Elektronik Kft. eScience Tudományos."

Hasonló előadás


Google Hirdetések